KEGG   Eremothecium cymbalariae: Ecym_4557Help
Entry
Ecym_4557         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00020  Citrate cycle (TCA cycle)
erc00640  Propanoate metabolism
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
erc01130  Biosynthesis of antibiotics
erc01200  Carbon metabolism
Module
erc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
erc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ecym_4557
   00640 Propanoate metabolism
    Ecym_4557
Enzymes [BR:erc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Ecym_4557
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ecym_4557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 11470146
NCBI-ProteinID: XP_003646408
UniProt: G8JU88
Position
4:complement(1095156..1096115)
Genome map
AA seq 319 aa AA seqDB search
MLRHIARRCFSRESTPYDSTIKNLLLPKDTKVIFQGFTGKQATFHAKISQEYGTNVVGGT
NPRKAGQTHLGQPVFSTVAEAVQVTGATASGIFVPPPIAAPAIREAIEAEIPLAVCITEG
IPQHDMLYIAEMLKSQDKTRLVGPNCPGIINPRSHVRIGIQPTKIFTPGKIGIVSKSGTL
TYEAVQQTSLTGLGQTLVIGIGGDAFPGTDFIDALKLFMEDESTEGIILLGEIGGKAEIE
AAEFLKAYNLTRDKPMPVASFIAGTVAGQMKGVRMGHSGAIVEGSGTDAESKKAALREAG
VAVVESPGHLGQALVKQFN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttaagacatattgctcgtcgttgcttctcacgggagagcacaccttatgatagcacc
atcaagaatttattgttacctaaggataccaaggtaatctttcagggtttcacggggaaa
caagccacattccacgccaagatctctcaagagtacgggactaatgtggttggtggtacc
aatcccaggaaggcggggcagacgcatttggggcagcccgtgttttccacggttgctgag
gctgtgcaggtgactggggctactgcttctggtatttttgttccaccaccaattgcagct
cctgctattagggaagcgattgaggccgagattccattggctgtgtgtatcactgaggga
atcccacagcatgatatgttatatattgcggagatgttgaagtcgcaagacaaaacacgt
ttggtgggtcccaactgtccagggatcatcaaccctcggtctcatgtgagaatcggtatt
caacccaccaaaatctttacgcccggtaagattgggattgtttcaaagtctggcactcta
acctacgaggcggtacagcagacgtcgttaactgggctaggtcaaactttggttattggt
atcggtggggatgcattccctggtacagactttattgacgccttgaagttattcatggag
gatgaatccactgagggtattattttgttgggagagatcggtggcaaggcggagatcgag
gctgcagagttcttgaaggcctataacttgactagagacaaaccaatgcctgttgcttct
tttattgctggtactgttgcaggccaaatgaagggtgtcagaatgggccattctggtgcc
attgttgaaggttccggtactgatgcagagtccaagaaggccgctctaagagaagctggc
gttgctgttgttgagtcccctggccatttaggacaagcgttggtcaagcaatttaactga

DBGET integrated database retrieval system