KEGG   Eremothecium cymbalariae: Ecym_4776Help
Entry
Ecym_4776         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00450  Selenocompound metabolism
erc00970  Aminoacyl-tRNA biosynthesis
erc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Ecym_4776
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ecym_4776
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:erc01007]
    Ecym_4776
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:erc03016]
    Ecym_4776
Enzymes [BR:erc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Ecym_4776
Amino acid related enzymes [BR:erc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Ecym_4776
Transfer RNA biogenesis [BR:erc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Ecym_4776
 Prokaryotic type
   Other AARSs
    Ecym_4776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g MetRS-N tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 11470256
NCBI-ProteinID: XP_003646605
UniProt: G8JSR6
Position
4:1510230..1512488
Genome map
AA seq 752 aa AA seqDB search
MPFEISFDKNKTQLSGLQLATNIKLALALQLGDISASKIAVNDEAVGPQLFGPPLFRLFD
SNAILRYVMDDFEGLDSEEGLFALSSVEAVLHHKSIQKEHVESIASKSLDSYLLSLQEPL
SATKLITFANTYALCSEAVIEKFPVFPDYLSRALEVAQQQTPRSSAQFKNTGSTNIQEGH
EVKEQPKEILPKEGERNILITSALPYVNNVPHLGNIVGSVLSADIFARYAKARNYNTLFI
CGTDEYGTATETKALEEGISPRELCDKFHSIHSEVYKWFQIGFDYFGRTTTDLQTEIAQG
IFTDLYNNGFLEEHSMKQLYCPEHKGYLADRYVEGSCPKCEYEDARGDQCDKCGSLLDPF
ELINPRCKLDNATPEPRNSDHVFLSLDKLEQDIVDWVAKASEEGAWSKNSKNITTSWLKE
GLRPRCITRDLVWGTPVPLEKFKEKVLYVWFDAPIGYISITANYTKRWEQWWKNPENVSL
YQFMGKDNVPFHTVIFPGSQLGTGDNWTMLHHLNTTEYLQYEGGKFSKSRGIGVFGNNAQ
DTGISPSVWRYYLASVRPETSDSQFSWSDFVARNNNELLANLGNFVNRLIKFVNAKYNGV
VPTYDVKYLPNFEKLSGDINNILSSYIEEMEQAHQKRGLEIAMSLSARGNQFLQENRLDN
TLFSKFPTKSDAVIGVGLNIIYALASIISPFMPETADSIYRMLNAPPLAIEETFHLLIGG
GHTIKQAEYLFQRVEEAMIAKWRNKYNGKQDV
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgagatatcttttgacaaaaataagacgcagctctctggtttgcaactagcg
accaacattaaattagctttagctttacaattaggcgatataagtgcttccaaaattgcc
gttaatgatgaagctgtgggtccgcaattatttggtcctcctttgttccgactttttgac
tcgaatgcgatcttgcgatatgttatggacgactttgaaggtttagattcagaagaaggt
ctttttgcgctgtcatccgttgaggcagtgcttcatcataagtctatccagaaggagcat
gttgaatcgattgcatcaaaatcgctagacagttatttactttcacttcaagaaccatta
tctgcaaccaagttaattacttttgcgaacacatatgctctatgctctgaagctgttatt
gagaagtttccagtatttccagattacctctctagggccttggaggttgcgcagcaacaa
accccacgatcatctgcccaattcaagaatactggttccacgaatatccaagagggtcac
gaagtaaaggagcagcctaaagagattctgcctaaagagggggagcggaacatattgatt
acttctgccttgccttatgttaataatgtccctcatttggggaatattgtgggaagtgtc
ttatcagcagatatctttgcccgttatgcaaaggccagaaattacaatactctatttata
tgcggtactgatgaatatgggactgcaacagagacgaaagccttggaagagggtatttct
cctcgtgaattgtgcgacaagtttcattcgatccactctgaagtgtacaaatggttccaa
attgggtttgattatttcggccgaactacgacagaccttcagaccgagatcgcccagggt
atctttactgacttatacaataacggtttcttggaagaacattctatgaaacagttgtac
tgtccagagcataagggatatttagccgatagatacgttgagggaagttgtccgaagtgt
gagtatgaggatgcacgtggtgatcagtgtgataaatgtggtagtttattagatcctttt
gaacttattaatcctcgttgtaaattggacaacgccactccagaaccacgtaattctgac
catgtatttttgtccctagataagttggagcaagatattgtcgattgggtagcaaaggct
tcagaggaaggtgcctggtctaaaaattctaagaacattaccacatcctggctaaaagaa
ggcttaagaccacgctgtatcactagggatttagtttggggtactcctgttcctttagaa
aagttcaaagagaaggttttatacgtttggttcgatgccccaataggttatatttcaatc
acggctaattacaccaaacgctgggagcaatggtggaaaaatccagaaaatgtttccctc
tatcagtttatgggtaaggataatgttccatttcacacggttattttcccaggttctcaa
ttgggtactggtgacaattggactatgttacatcatttgaataccactgaatatttacaa
tatgagggtggtaagttctctaagagcaggggtatcggtgtttttgggaacaatgctcaa
gacacaggtatttctcctagtgtttggcgatactacttagcgtcagttaggccagaaaca
agtgactctcaattctcttggagtgatttcgttgcaagaaacaacaatgagttattagcc
aacttgggaaactttgttaacagattgattaaatttgttaacgccaagtacaatggcgtg
gtcccaacatatgatgttaaatatttgccaaactttgaaaagttaagtggtgacatcaat
aacattttatcatcatacattgaagagatggaacaagcacatcaaaaacgtggtttggag
atcgccatgtcattgtctgctcgtggtaatcaatttttacaagagaacaggttggataat
accttattttccaagttcccaaccaaatctgatgctgttataggtgtcggtttgaacatc
atttatgctttggcctccattataagccccttcatgccagagactgctgatagcatttat
agaatgttaaatgctcctcctttggcaattgaagaaacattccatttactcattggaggc
ggtcataccattaagcaggccgaatatcttttccaacgtgttgaagaagctatgattgca
aagtggaggaacaagtacaatggtaagcaggatgtttga

DBGET integrated database retrieval system