KEGG   Eremothecium cymbalariae: Ecym_5658Help
Entry
Ecym_5658         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
erc  Eremothecium cymbalariae
Pathway
erc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:erc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Ecym_5658
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:erc03012]
    Ecym_5658
Translation factors [BR:erc03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    Ecym_5658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-3c_N PCI Ribosomal_L27_C
Motif
Other DBs
NCBI-GeneID: 11472121
NCBI-ProteinID: XP_003647208
UniProt: I6NE99
Position
5:1324331..1326790
Genome map
AA seq 819 aa AA seqDB search
MSRFFSRGYHYDSASSSEEEELLSSSEEELLASSDEEELVSDDSFFNDSESESVESDDDS
DSKPYGPDWFKKPQFRKAGTSSGATGASRFLKSNHYAGSDDSDDEGKKVVKSGKDKLLDE
MNASYSRIDAADLTQDWVTILSEFENVTKLLVKAQQQNFGTPNVFIKVVAQVEDLVAGTS
QSDIKNKAVSKAYNTVKQRVKKIARDIEVLLAKFRESPAAFDKETTVEFTQSKEMSGTPF
MLGIGSKSFDMSSVATGSSQSDFFSALHIVIDSRGKKGTDIQGQIKTMAELVEIAKTPYE
SIVAYLNLIPIRFDACSGLAYQPLEQWKAVHDNVVDLLTILEANIGSYHVTELAPRNEFI
EDEPVPNEQGVKEILGSVFSFVERLDDEFNKSLLNTDPHSSDYLDRLRDEQSIYSLILRS
QLYLESVLPESSAGRYLARSFVRRLDHIYYKPSKLVEIIERAAWAKAPNGATSKYITYSS
DPDYIGKLIDTLCTFVSNEHDQLLKKRATLYQIYFYALNNEFKKGKDMLVESNVRTAINS
QDPTIQILFNRVVVQLGIAAFKLCLVEDCHQILNEVSTASHLRDILGQQSLQRASNNVGA
NGTATPTEQLCLPFHQHINLDLIDAVFMTCSLLIEIPHMAAFFSGIKVKRIPYSQKSIRR
ALEHYEKSSFQGSPETLRDHVIHAAKAMQKGNWSQCIQYLRGISTWSLLGNNVEEVFIKL
SERVQIESLKTYIFTYKRFYSKLSVAKLSQLFSLPNEQVIEVVESLTDGMNIKGSLNESK
EMIIFERGDEITKLEEVAIKLNKETKYQIERLNNVSQRQ
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttttttctcccgtgggtaccactatgatagtgcttcttctagtgaagaagaa
gaattattgtcctcttcagaagaggagttgttggcgtcttcggatgaggaagaattagta
tcagacgactctttttttaatgattcggaatctgaatctgtggaatctgatgatgattcc
gatagtaaaccatatggaccagattggtttaagaaaccgcagtttaggaaagcagggact
tcgtctggtgcaactggtgcaagcaggttcttgaagagcaaccattatgctggttcggat
gattcggatgatgaaggtaagaaagttgtgaaatctggtaaagataaattattagatgaa
atgaatgcatcatatagcaggatcgatgcagcggacctaactcaggattgggttactatt
ctttctgagtttgagaatgtgactaagttactagtcaaggcacagcagcagaactttggc
acgcctaatgtattcatcaaagtagttgcacaagttgaagatttggttgctggtacctcc
caatcggacatcaagaacaaagctgtttccaaggcttataataccgtgaagcagagagtt
aaaaaaattgccagagatattgaggtattgcttgctaagttcagggagtcgccggctgcc
tttgataaggaaactactgtggaatttacacaatcaaaggagatgtctggtactccattt
atgttaggtattggttcaaagtcctttgatatgtcttcagttgctacaggttcttcacaa
tctgattttttcagtgcattgcatattgttatcgattctagaggtaaaaaaggtactgat
attcaaggccagatcaagactatggctgaattggtcgaaattgcgaagactccgtacgaa
tctattgttgcgtacttgaatttaattccaattagatttgatgcctgttccggtttagcg
taccagcctctagaacaatggaaagctgttcatgataatgttgttgatttgttaaccatt
ttggaggctaatattggtagttatcacgtcacggagcttgccccacgtaatgaatttata
gaggatgagcccgttccaaacgaacaaggtgttaaagaaattttgggttctgtcttttcc
ttcgttgaaagattggatgatgaatttaataaatcgttgctgaataccgatccccactcc
agtgattacttggaccgtctaagggatgaacaatctatctatagcttgatcttaagatca
cagttatacttagagtctgttttacctgaatcctccgcgggcaggtatttagcacgttcg
ttcgttagaagattagaccatatttattacaagccatccaagcttgtggaaattatcgaa
cgtgctgcgtgggcaaaagctcctaatggtgctacttctaaatatatcacctattcctca
gatcccgattatatcggtaaactaattgatacgttgtgtaccttcgtatccaatgaacat
gatcaattgttgaagaaacgtgcaactttgtaccaaatttatttctatgcattgaacaat
gagtttaagaagggtaaagatatgttagtcgagtccaatgtgaggaccgctatcaattcc
caagatcctacgatacagattttgttcaacagagtagttgttcaattaggtatagctgca
ttcaaactgtgtttggttgaggattgtcatcaaattctcaatgaagtctcaactgcctcc
catctcagagacattttgggacaacagtcactacaaagagcttctaacaatgttggtgcc
aatggcactgccactccaaccgaacaattatgcttaccattccaccaacatatcaacctg
gatctgattgatgctgtctttatgacatgttcactattgattgaaattccacacatggca
gccttcttttctggtatcaaagtcaagagaattccttattctcaaaagtctatccgtcgt
gctttagagcactacgagaaatccagctttcaaggttcaccagagactttgagagaccat
gtcattcatgctgctaaagctatgcaaaagggtaattggtcacaatgtattcaatatttg
agaggtatttctacttggtccttattgggtaataatgtcgaagaagtatttatcaaattg
agcgaaagagtacaaattgaatccttgaagacatatatttttacatacaaaaggttttac
agtaaactgtctgttgctaagctatcacagctgttcagcctgcccaatgaacaagttatt
gaggtcgttgaatctttgacagatggtatgaacatcaaaggttctctgaacgagtcgaaa
gaaatgattatttttgagaggggtgatgagattaccaagttggaggaagttgcaataaag
ttgaacaaggagacaaaataccaaattgaacgtttgaataatgtttcccaacggcaataa

DBGET integrated database retrieval system