KEGG   Eremothecium cymbalariae: Ecym_8066Help
Entry
Ecym_8066         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00780  Biotin metabolism
erc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Ecym_8066
Enzymes [BR:erc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     Ecym_8066
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     Ecym_8066
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     Ecym_8066
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     Ecym_8066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB BPL_C DJ-1_PfpI
Motif
Other DBs
NCBI-GeneID: 11469847
NCBI-ProteinID: XP_003648179
UniProt: G8JWY8
Position
8:complement(144987..147047)
Genome map
AA seq 686 aa AA seqDB search
MNVYIYNGPGTSSESVSQTVTILRHFLEPYYAVSTISPRSLSNEAWYSKTSALVFPGGAD
IPYVKACKSATALIKKFVSKQGGIYIGICAGSYFGSGRVEFDVDGPLGVVGNRDLQFFPG
IARGPAFRGFEYNSEAGARAPILKPSNADGEEFAVYFNGGPVFVDAHKYANVEILAEYQE
DLDVPCSDDIDSAQIPSAASVILCKVGKGKALLSGAHFEFNPGLLMTSQRKDDKRKIIDT
LKEHEKARLAFLREILIKAGLRFNTSRLSSQIPSLTPLVACSVHNGQLLHQFAESLKGES
TKEGNRFEFKSNADTFHLYQGFSAYESTRDDLRDKDLNIVIKPLLIGTDHDMLPSPALTP
NFDIKKYFDNLNADTSLGSILLYGEVVTSTSTLLDSNKTLLHKMPENSVLFVSTLQVAGR
GRGNNVWVNPRGVSASTVCINLPVVSPRTGDKISIAFVQYLSMLAYCEAILSYAPGFEDI
PIRIKWPNDMYALDPEYYRRNDIKLVGKGIKSNIIPLSEVERVYVKISGMLVNSNFINNK
YSLLIGCGINLFNEAPTTSVMTWVNILNKERALVDLDPLPKIEIERLLALYMTKLGSLIS
DFINYGPKLALPRYYRLWLHSGQIVHLQDYNNTRAMITGITSDYGLLIARELKQGSDNEF
TGLEYTLQPDGNSFDIFKGLISKKLT
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgtatatctataatggtcctggtactagttcagagtcggttagtcaaacagtt
accatcctacggcatttcttagaaccatattatgcggtttctacgatatccccaaggtct
cttagcaacgaggcatggtattcaaaaacgtcagctctggtttttcctggtggtgcagac
ataccatatgttaaggcttgcaaatctgctactgcattaatcaagaagtttgtgtctaag
caaggcggaatatatattggtatctgtgctggtagttattttggtagtggtcgtgtggaa
tttgatgtggatggacctttgggggttgttgggaatagagatctgcagttctttccaggt
attgctaggggacctgcattcaggggatttgaatataattctgaagcaggtgctcgggcc
ccaattttgaagccttctaatgctgatggagaagagtttgctgtgtattttaatggtggg
ccagtctttgttgatgcacataagtatgcaaatgttgaaatattggccgaatatcaagaa
gacttggatgttccatgttctgacgacatcgattctgcgcaaatccctagtgcagcatca
gtcatactatgtaaggttggaaagggtaaggcactattgtcaggggctcattttgagttc
aatcctgggctattaatgacatcccagaggaaagatgataaacgtaaaattattgatact
ttgaaggagcatgaaaaagctaggttggctttcttaagagaaattctgattaaggctggt
ttacgttttaatactagtaggttatcttctcaaattccaagtttaacgccacttgtcgcc
tgctcggtgcataatgggcaactacttcatcaatttgctgagtcccttaagggtgagtct
acaaaagaaggtaatagatttgaattcaaaagcaatgccgacacctttcatctgtaccag
gggttctcggcttatgaatctactcgagatgatttaagagacaaggacctaaatattgtc
attaagccacttcttattggtacagatcatgacatgttgccatcacctgcattaacacct
aacttcgacataaaaaagtatttcgacaatctgaatgctgatacatcactaggctccata
cttctttatggagaagttgtaacttccacgagcacattattagactcgaacaaaacatta
cttcataagatgccggagaactccgttttatttgttagtaccttgcaggttgctggaaga
gggcgtggaaataatgtttgggttaatccaagaggtgtttctgcctcaactgtttgcatt
aacttaccagttgtatctcctaggactggcgataaaatttcaattgcttttgtgcaatac
ctgtccatgctcgcgtattgcgaagctatcttatcatatgctcccggttttgaggatatt
cctataagaattaagtggcccaatgatatgtacgcattagacccagaatattaccgcaga
aatgatatcaaattggttggtaagggcataaagtcgaatattatacctctttctgaagtt
gaacgtgtgtacgtaaaaatatcgggcatgcttgtaaattccaacttcataaacaacaaa
tactctttgctgataggttgtggtattaacttatttaatgaagctccaacaacttcagtg
atgacttgggtgaacattttgaataaggaacgcgctttggttgacttggatccgttgccg
aagattgaaattgaaaggttattggctttatacatgacgaaattgggtagtttaatttcg
gactttataaactatggtcccaaattagcattgccaagatattatcgactatggttacat
tctggtcaaattgttcacttacaagattacaacaatactagagcaatgattacgggaatt
acttctgactatggattgcttattgctagggaattaaaacaagggagcgataatgaattt
acaggtttagaatataccttacaaccagatggaaattctttcgatatatttaagggattg
atttccaagaagctgacttag

DBGET integrated database retrieval system