KEGG   Eubacterium rectale ATCC 33656: EUBREC_0469
Entry
EUBREC_0469       CDS       T00909                                 

Name
(GenBank) hypothetical protein
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00620  Pyruvate metabolism
ere00640  Propanoate metabolism
ere00650  Butanoate metabolism
ere01100  Metabolic pathways
ere01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ere00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EUBREC_0469
   00640 Propanoate metabolism
    EUBREC_0469
   00650 Butanoate metabolism
    EUBREC_0469
Enzymes [BR:ere01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     EUBREC_0469
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACR74260
UniProt: C4ZBX0
Position
427422..429674
AA seq 750 aa
MIEMKEWDGFEGRLWKEEINVRQFIQDNYTPYDGDESFLADPTDATNKLWDALQKLQKEE
RAKGGVLDMETEVVTGITAYGPGYIDESLKDLEQIVGLQTDKPLKRAFMPYGGIKMAVQA
AETYGYNVSDKLKEIFTKYHKTHNTAVFDAYTPEMMKVRHAKILTGLPDTYGRGRIVGDY
RRVALYGLDYLIEEKKKDKANCGCGQMTDDVIRLREEIAEQIKCLEDMKKLAEIYGYDIS
RPATNAKEAVQWLYFGYLAAIKTQNGAAMSVGRVSTFLDIYIKRDMDKGILTEQEAQELI
DHFTMKLRMVKFARIPSYNQLFSGDPVWATLDVAGTGVDGRSMVTKTDFRFLHTLENMGP
APEPNLTVFYSSKLPQTFKDYAARISIETSSIQYENDDAMKPVWGDDYAICCCVSATQTG
KEMQFFGARANLAKCLLYAINGGVDEKSGEQVGPNYAPITAEYLDYDEVMAKYDKMMDWL
VDIYVNTLNLIQYMHDKYYYEAAELALMDTDLKRTFATGIAGFSHVIDSLSAIKYAKVKV
VRDESGLAKDFEIEGEFPKYGNDDDRADEIGVWLLKTFMDKLKKHHTYRDSEPTTSILTI
TSNVVYGKATGAMPDGRKAGEPLSPGANPSYGAEQNGLLASLNSLTKLPYEWALDGISNT
QTINPGALGNNEGERIDNLVNVMDGYFDQGAHHLNVNVFGKEKLIDAMEHPEKEEYANFT
IRVSGYAVKFIDLTREQQLDVISRTCHERM
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgatagaaatgaaagagtgggatggatttgaaggacgtctttggaaagaggaaatcaac
gtccgtcagtttattcaggacaactacactccatacgacggagacgagagctttttagct
gatccgacagatgctacaaacaagctgtgggatgcactccagaaattacagaaagaggag
cgtgccaagggcggagttcttgacatggagacagaggttgtaacaggaatcacagcttac
ggccctggatatatagatgagtcattaaaggacctcgagcagattgtaggtcttcagaca
gataagccgttaaagagagcattcatgccttacggtggaatcaagatggcggtgcaggct
gctgagacatatggttacaatgtaagcgacaagctcaaggagattttcacaaaatatcat
aagacacacaacacagcagtattcgatgcatacacacctgagatgatgaaggtccgtcat
gcaaagatccttacaggtcttcctgacacatacggccgtggacgtatcgtgggcgattac
cgtcgagtagcgttatacggacttgattatctcatcgaggagaaaaagaaggataaggca
aactgtggctgtggacagatgacagatgatgttatccgtttaagagaggaaatcgcagag
cagattaaatgtcttgaggatatgaagaagcttgcagagatttacggatatgatatctca
agacctgcaacaaacgcaaaagaggcagttcagtggttatacttcggataccttgcagca
atcaagacacagaatggtgcagcaatgtcagtaggacgtgtatctacattccttgacatt
tacatcaagagagatatggacaagggcatcctcacagagcaggaagcacaggagctcatt
gaccattttacaatgaagcttcgtatggttaaatttgcacgtatcccttcatacaaccag
ttattctcaggtgatcctgtatgggcaacacttgacgtggcaggaacaggtgtggacgga
cgttcaatggttacaaagacagacttccgtttcctccatacattagagaacatgggacct
gcaccggagccaaacctcacagtattctactcatcaaagcttcctcagaccttcaaggat
tatgcagcccgcatctcaattgagacaagctcaatccagtatgagaacgatgatgcaatg
aagcctgtatggggcgatgattatgcaatctgctgctgtgtatctgcaacacagacaggt
aaagaaatgcagttcttcggagcacgtgcgaaccttgcaaaatgtctcctctacgctatc
aacggtggtgttgatgagaaatcaggtgagcaggtaggaccaaactacgcacctatcaca
gcagagtaccttgactatgacgaggtaatggcgaaatacgacaagatgatggactggtta
gtagacatttatgtaaatacattaaaccttatccagtacatgcatgacaaatactactat
gaggcagcagagcttgcactcatggatacagacttaaagagaacattcgcaacaggaatc
gcaggattctcacacgtaatcgattctctttcagcaatcaaatatgcaaaggttaaagta
gtacgtgacgagagcggactggcaaaggatttcgaaattgagggagagttccctaaatac
ggaaacgatgatgaccgcgcggacgaaatcggtgtatggcttcttaagacattcatggac
aagttaaagaagcatcacacataccgtgattcagagcctacaacatcaatccttacaatt
acatcaaacgtagtatacggaaaagctacaggagcaatgcctgacggacgtaaagccgga
gagccactctcacctggagcaaacccatcatacggcgcagagcagaacggacttctcgca
tccttaaactcactcacaaagcttccatatgagtgggcacttgatggaatctcaaataca
cagaccatcaacccgggagcactcggaaacaacgagggtgagagaattgacaaccttgta
aacgtaatggacggatacttcgatcagggtgcacatcacctcaatgtaaacgtattcggt
aaagagaagctcatcgatgcaatggagcatcctgagaaggaggagtacgcaaacttcaca
atccgagtatcaggatacgcagttaagttcatcgacctcacaagagagcagcagctcgat
gtaatctcacgtacatgccacgagagaatgtaa

DBGET integrated database retrieval system