KEGG   Eubacterium rectale ATCC 33656: EUBREC_3574
Entry
EUBREC_3574       CDS       T00909                                 
Name
(GenBank) Hypothetical protein
Organism
ere  Eubacterium rectale ATCC 33656
SSDB
Motif
Pfam: P-loop_TraG AAA_10 DUF87 FtsK_SpoIIIE CtsR HTH_8
Other DBs
NCBI-ProteinID: ACR77300
UniProt: C4ZE37
Position
complement(3349227..3351488)
AA seq 753 aa
MLQDGICQVTKTFFSKTIQFYDINYQLALNEDKTTIFENYCDFLNYFDSSISVQLSFINQ
QVDVAEFEKSIDIPDQNDDFNAIREEYRTMLKNQLSKGNNGLVKTKYITFGIEAESLKVA
RPRLERIEADILNNFKVLGAQAHSLNGLERLEILYHVFNQDRIEPFKFQYKMLPETGLKT
KDFIAPTSFNFSKNQTFLMGKTMGSVSYLQILAPELTDRMLADFLDVDDSINVNIHIQSI
DQSSAIKMIKSKISDLDKMKIEEQKRAVRSGYDMDVLPSDLVTYGEEAKNLLEDLQSRNE
RMFLVTVLVMNTAKKRQKLDNNIFQVQGIAQKYNCSLKQLDYQQEAALMSCIPLGVNRIE
IQRGLTTSATAIFVPFTTQELFQEGEALYYGLNALSNNMIMVDRKRLKNPNGLILGTPGS
GKSFSAKREITNCFLITEDDIIICDPEAEYYPLVQALHGQVIRISPVSDQYINPMDLNLN
YSEEDNPLSLKADFILSLCELIVGGKNGLEPVEKTIIDRCVRLVYQEYLADPVPEKMPIL
EDLYNLLRKQEEPEAQRLATSLEIYVTGSLNVFNHRTNVDINNRIVCFDIKELGKQLKKI
GMLIVQDQVWNRVTINRSAHKSTRYYVDEFHLLLKEEQTAAYSVEIWKRFRKWGGIPTGI
TQNIKDLLASREIENIFENSDFIYMLNQASGDRQILAKQLNISPTQLSYVTNSNEGEGLL
FYGNVIIPFVDRFPKNSLYKIMTTRPEETAEAG
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgctgcaggatggtatctgccaggtgacaaagacctttttctctaagacaattcagttt
tatgacatcaattatcagctggctttaaatgaggataagaccacgatatttgagaattac
tgtgattttttaaattactttgattcttccatcagtgtgcagctgtcctttatcaatcag
caggtggatgtggctgaatttgagaaaagtattgatattccggatcagaacgatgacttc
aatgccattcgtgaggagtaccggaccatgttaaaaaatcagctttccaagggaaacaat
ggtctggtgaaaaccaagtatatcacttttggaatcgaagcagaaagcctgaaggtggca
agaccaaggcttgaaaggattgaagccgatatcctgaacaactttaaagttctgggagca
caggcacattccttaaatggtctggagcgactggagattctgtatcatgtgttcaaccag
gatcggattgaaccatttaagttccagtacaagatgctgccggaaacaggattaaagacc
aaagactttattgcaccaacttcctttaacttttccaagaatcagacatttctgatggga
aagaccatgggaagcgtgagttatctgcagatcctggcaccggagcttacagaccggatg
cttgcagatttcctggatgtggatgacagcatcaatgtcaatattcatatccagtccatt
gaccagagttctgcgatcaagatgatcaagagcaagatttcagatttggataagatgaag
attgaagagcagaagcgggcggtacgttccgggtatgacatggatgtgcttccatcggat
cttgtgacctacggggaagaagcaaagaatctgctggaagatttacagtccagaaatgag
cgtatgtttcttgtgacagtgttggtgatgaataccgcaaagaagcgtcagaagctggat
aacaatatcttccaggtacagggtatcgcacaaaaatacaactgttccttaaaacagctg
gactatcagcaggaagcagcattgatgtcctgtattccactgggagtcaatcgaattgag
attcagagagggcttaccacatcggcaacagcgatctttgtgccatttacgacacaggaa
ctgttccaggaaggggaagctctttattatggattgaatgcattatccaacaacatgatt
atggttgaccggaagcgtctgaagaacccgaatggactgattcttggtacacctggttcc
ggtaaatccttctcagcaaaaagagaaattacgaactgtttcctgattacggaggacgat
attattatttgtgatccagaagccgagtattatccactggtgcaggcactgcacggacag
gtcatccggatttcaccggtatcagaccagtatatcaatccgatggatctgaacctgaat
tattcagaggaagataatccgctgtccttaaaggcagattttattctgtccctgtgtgaa
ctgattgtcggtggaaagaatggactggaaccggtagaaaagacgatcattgaccgttgt
gtgcggctggtctatcaggaatatctcgctgatccggtgccagagaagatgccgatactg
gaggatttatataatctgttgcggaaacaggaagagccggaagcacagcgtctggcaact
tcattggagatttacgttacaggttccctaaatgtatttaatcatcgcacaaatgtggac
atcaacaaccgtatcgtatgttttgatatcaaggagcttggaaaacagctgaagaagatc
gggatgctgattgtgcaggaccaggtatggaaccgagtgacgatcaaccgttccgctcat
aaatccacccgttactatgtggatgaattccatcttctcttaaaagaagaacagacagca
gcctacagcgtggaaatctggaagcgattccgtaaatggggcggtattccgacaggaatt
acccagaacattaaggatcttttagcttccagggaaatcgagaatatttttgaaaactct
gattttatctatatgctcaaccaggcatccggtgacaggcagattctggctaaacagttg
aatatttcaccaacccagctgtcttatgtaaccaacagtaatgagggtgaaggacttctg
ttctatggaaatgtgattattccgtttgtagacagattcccgaagaattccctttataag
attatgacaacccgcccggaggaaacagccgaagcagggtaa

DBGET integrated database retrieval system