KEGG   Eubacterium rectale ATCC 33656: EUBREC_0420Help
Entry
EUBREC_0420       CDS       T00909                                 

Definition
(GenBank) 50S ribosomal protein L23
  KO
K02892  large subunit ribosomal protein L23
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ere00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EUBREC_0420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ere03011]
    EUBREC_0420
Ribosome [BR:ere03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EUBREC_0420
  Bacteria
    EUBREC_0420
  Archaea
    EUBREC_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L23 zf-C3HC4_5
Motif
Other DBs
NCBI-ProteinID: ACR74211
UniProt: C4ZBS1
Position
385150..385449
Genome map
AA seq 99 aa AA seqDB search
MANVQYYDVILKPVVTEKSMNAMAEKKYTFLVHPDANKTMIKEAVERMFEGTKVAKVNTM
NCEGKNKRRGMVTGKTAKTKKAIVQLTADSKDIEIFAGL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgtacagtactatgatgtaatcctcaaaccagtagtaactgagaagagtatg
aatgcaatggctgagaagaaatacacattccttgttcacccggatgcaaacaagactatg
atcaaagaagcagtagagagaatgttcgaaggaacaaaggttgccaaagttaacacaatg
aactgcgaaggcaagaacaagcgtcgtggaatggtaacaggaaagactgctaagacaaag
aaggctatcgtacagcttacagcagacagcaaagatatcgagatcttcgcaggactgtag

DBGET integrated database retrieval system