KEGG   Eubacterium rectale ATCC 33656: EUBREC_0733Help
Entry
EUBREC_0733       CDS       T00909                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00071  Fatty acid degradation
ere00280  Valine, leucine and isoleucine degradation
ere00310  Lysine degradation
ere00362  Benzoate degradation
ere00620  Pyruvate metabolism
ere00630  Glyoxylate and dicarboxylate metabolism
ere00640  Propanoate metabolism
ere00650  Butanoate metabolism
ere00900  Terpenoid backbone biosynthesis
ere01100  Metabolic pathways
ere01110  Biosynthesis of secondary metabolites
ere01120  Microbial metabolism in diverse environments
ere01130  Biosynthesis of antibiotics
ere01200  Carbon metabolism
ere01212  Fatty acid metabolism
ere02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ere00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EUBREC_0733
   00630 Glyoxylate and dicarboxylate metabolism
    EUBREC_0733
   00640 Propanoate metabolism
    EUBREC_0733
   00650 Butanoate metabolism
    EUBREC_0733
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EUBREC_0733
   00072 Synthesis and degradation of ketone bodies
    EUBREC_0733
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EUBREC_0733
   00310 Lysine degradation
    EUBREC_0733
   00380 Tryptophan metabolism
    EUBREC_0733
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EUBREC_0733
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EUBREC_0733
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EUBREC_0733
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ere04147]
    EUBREC_0733
Enzymes [BR:ere01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EUBREC_0733
Exosome [BR:ere04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EUBREC_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF1153 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACR74519
UniProt: C4ZEK3
Position
677347..678531
Genome map
AA seq 394 aa AA seqDB search
MAKKVVIASACRTAIGKMGGALSNTPAADLGAIVIKEALNRAGVAPEMVDEVKMGCVIQA
AQGQNVARQASIKAGLPIEVPAITINVVCGSGLKCVNDAATMIKAGEADIVVAGGMENMS
MAPYAMTKARFGYRMNNATIIDTMVNDALTDAFNHYHMMITAENVCDKYGITREELDEFS
ANSQQKCEAAIAAGKFDDEIVPVPVKVKKEIVEFKKDEGPRAGTTVETLSKLRCCSGKEG
GLVTAGNASGINDGAAAVVVMSEEKAKELGVKPLATWVAGALGGVEPEIMGVGPVASTKK
VLAKTGLTIDDFDLIEANEAFAAQSIAVARDLGFDMSKVNVNGGAIALGHPVGASGCRIL
VTLLHEMQKRGSNRGLATLCIGGGMGCSTIVEKY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagttgtaatcgcaagtgcttgccgtacagcaatcggcaaaatgggcgga
gcattaagcaatactccagccgcagatttaggtgcaatcgtaattaaggaggctttaaac
cgtgcaggtgttgctcctgagatggttgacgaggttaagatgggttgtgttatccaggca
gctcagggacagaacgtagctcgtcaggcttctatcaaggcaggacttccaatcgaggtt
ccggctatcacaatcaatgtcgtttgtggatcaggtcttaagtgtgtaaacgacgctgct
acaatgatcaaggccggtgaggctgatatcgttgttgccggtggtatggagaacatgtca
atggctccttacgctatgacaaaggcacgtttcggatacagaatgaacaatgcaacaatc
atcgatacaatggttaacgatgctcttacagatgcattcaaccactatcatatgatgatc
acagctgagaatgtatgtgataaatacggcatcactcgtgaagagcttgatgagttctca
gcaaactcacagcagaagtgtgaggcagctatcgcagcaggcaagttcgatgatgagatc
gttcctgtacctgttaaggttaagaaagaaatcgttgagttcaaaaaggacgagggacct
cgtgccggaacaacagtagagactctttctaagcttcgttgctgctcaggtaaagagggc
ggacttgttacagccggtaacgcatcaggaatcaatgatggtgctgcagcagtagttgta
atgagcgaagagaaagctaaggagctcggtgttaagccattagctacatgggtagcagga
gcacttggcggagttgagcctgagatcatgggtgttggaccggtagcttctacaaagaag
gttcttgcaaagacaggtcttacaattgatgatttcgatcttatcgaggcaaacgaggca
tttgctgcacagtcaatcgctgtagcaagagatcttggtttcgatatgagcaaggtaaat
gtaaacggtggtgctatcgcactcggacatcctgtaggagcttcaggctgtcgtatcctt
gttacattattacatgagatgcagaagagaggatctaacagaggtcttgcaacactttgt
atcggtggtggaatgggatgttctactatcgttgagaagtactaa

DBGET integrated database retrieval system