KEGG   Eubacterium rectale ATCC 33656: EUBREC_0921Help
Entry
EUBREC_0921       CDS       T00909                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00010  Glycolysis / Gluconeogenesis
ere00030  Pentose phosphate pathway
ere00051  Fructose and mannose metabolism
ere00680  Methane metabolism
ere01100  Metabolic pathways
ere01110  Biosynthesis of secondary metabolites
ere01120  Microbial metabolism in diverse environments
ere01130  Biosynthesis of antibiotics
ere01200  Carbon metabolism
Module
ere_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBREC_0921
   00030 Pentose phosphate pathway
    EUBREC_0921
   00051 Fructose and mannose metabolism
    EUBREC_0921
  Energy metabolism
   00680 Methane metabolism
    EUBREC_0921
Enzymes [BR:ere01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EUBREC_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: ACR74685
UniProt: C4ZFV1
Position
822353..824206
Genome map
AA seq 617 aa AA seqDB search
MYNDKGNTKYLKLLKQNYSSSQDVIREIVNLSAIINLPKGTEFFLSDIHGEYEAFLHIMN
NCSGVIKEKVDLIFKDTISDYDRQELCTLIYYPREKMALLDEQGKIDSDWYAMTLNQLIL
VAKLLSSKYTRSKVRKALPEEYAYIIDELLHAQEDEDANQVRYHKQILKTIIDLEDADEF
IIALSALIKRLAVDHLHIVGDVFDRGGSADKILDLLYDYHSLDIEWGNHDILWMGAACGN
DACICNVIRNNLKYNNVEILENAYGISLRQLMLFGMKTYGIEDGIEAARAAITVMLFKLE
GQLILAHPEYEMGNRLMLDRLDELQDVGVDRKRFPTVDDERPYALSDEETVIMRKLHRQF
VTGQRLHKHVRFLYDKGGMYNVYNGNLLYHGCVPVDSNGAFDKLYIDGEFYHGRALLDKC
DEKARAAYVDNPYKDDVDFMWFLWGGEKSPLCGRRLKTFEMEYVTDKSMWEEPSNPYYSR
YYDKSFCCQILHEFGLYDDDAHIINGHTPVHAIEGENPVRANGKLFVIDGGFCRAMNKKT
GIAGYTLIYNSHGLRLKAHTPFTSVEDALINNTDIETSSEVEENDKRRMLVKDTDIGKRL
IGEIDDLHKLLENYRRL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacgataaaggtaatacaaaatatctgaagcttttaaaacaaaattattcatca
agtcaggatgtaatcagggagatagtcaatctttctgcgattataaacctgccaaagggc
acggagtttttcctgagtgatatacatggcgagtatgaggcttttttacatatcatgaac
aactgctcaggtgtgataaaggaaaaggtggatttgattttcaaggatacgatttctgat
tatgacagacaggagctttgcacgctcatatactatccaagagagaaaatggccctgctt
gatgaacagggcaagatagacagtgactggtatgctatgacgttaaatcagcttatactt
gtcgcaaagctgctctcatcaaagtacaccaggtcgaaggtcagaaaggctctgcctgag
gaatatgcgtacattatcgatgagcttttgcatgcgcaggaggatgaggatgcaaaccag
gtcagatatcacaagcagatattaaagactataattgatttggaggatgcggatgagttt
ataatcgctttgtctgcactgattaagaggcttgctgttgaccatctgcacattgtggga
gatgtatttgacagaggaggaagcgcggataagattctcgatctgctttatgattatcac
tcgcttgatattgagtggggcaatcacgacattctctggatgggtgcggcatgtggaaat
gatgcatgtatatgtaatgtcatccgcaacaatcttaaatacaacaatgtggaaattctt
gagaatgcctacggaataagcttacgacagctaatgctgtttggcatgaaaacatatggt
atagaggatggaattgaggctgcaagggcggccatcacagtaatgctttttaagcttgag
gggcagcttatacttgcacatcccgagtatgagatgggaaacaggctgatgcttgacagg
ctggacgagctgcaggatgtaggagtggacagaaagcgctttccaaccgttgatgatgag
agaccctacgcactaagtgacgaggagactgtcatcatgagaaagctgcacagacagttt
gtgacaggacagcgcctgcacaagcatgtcagatttttgtatgataagggcggcatgtac
aatgtatacaatggcaacctgctctatcatggctgtgttccggttgatagcaacggagcc
tttgataagctgtatattgatggtgaattttatcacggaagggcgttgcttgacaaatgt
gatgagaaggcaagggctgcgtatgtggacaatccttataaggatgatgtggactttatg
tggtttttgtggggaggagaaaaatcaccgctgtgcggcagaaggcttaagacctttgag
atggaatatgttacagacaagagcatgtgggaagagccttctaacccatattacagcagg
tattacgataagagcttctgctgtcagatactgcacgagttcgggctgtatgatgatgat
gcgcatatcataaatggacatacaccggttcacgcaatagagggagagaaccctgtcagg
gccaatggcaagctgtttgtgatagatggaggcttctgccgtgcgatgaacaagaaaacc
ggtatcgccggctatacactgatttacaattcacatggtctaaggctcaaggcacacacg
ccttttacatcggtggaggatgccctgataaataatactgacatagagacatcatcagag
gtcgaggaaaatgataagagacgtatgcttgtgaaggataccgatatagggaagaggctt
attggagagattgatgatctgcacaagcttcttgagaactacaggaggctgtag

DBGET integrated database retrieval system