KEGG   Eubacterium rectale ATCC 33656: EUBREC_1926Help
Entry
EUBREC_1926       CDS       T00909                                 

Definition
(GenBank) CbiP
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00860  Porphyrin and chlorophyll metabolism
ere01100  Metabolic pathways
Module
ere_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ere00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EUBREC_1926
Enzymes [BR:ere01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     EUBREC_1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase MobB
Motif
Other DBs
NCBI-ProteinID: ACR75670
UniProt: C4ZBD8
Position
complement(1814664..1816169)
Genome map
AA seq 501 aa AA seqDB search
MAKVIMVQGTMSNSGKSFLVAGLCRIFRQDGYRVAPFKSQNMALNSYITDEGLEMGRAQV
MQAEAAGIKPMVCMNPILLKPTNNTGSQVIVNGRVLKNMPAREYFAYKKTLIPDIKKAFK
KLEEYADIIVIEGAGSPAEINLKENDIVNMGLAHMVDAPVLLVGDIDRGGVFAQLLGTLM
LLTDEEKNRVCGLIINKFRGDKTILDPGIQMLEERGRVPVTGVVPYMDVQLEDEDSLTER
FDKKTDGLIDIAVIRYPRISNFTDFNVFEQMSEVTVRYVSTVNELRHPDIVFLPGSKNTM
GDLLWMRQNGLEAAVKKLSCEIPVFGICGGYQMLGASIADPDGVEEGGYMRGMELLPIDT
VLKDSKTRLQTSGEIAHVDGVLSRLSGCHFLGYEIHMGKSAYSTASDEQGACADRKNELN
NVISDGRNVYGSYIHGIFDTAEAARVIVDYIADKKGIDVNDSAIVSYKSFKEKQYDRLAD
TLREYLDMDAVYGMLREAKYD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtaattatggtacagggtacaatgtccaattcaggcaagagctttcttgtc
gcgggcttgtgccgcattttcagacaggacggatacagagtggcaccgtttaaatcacag
aacatggcgctcaactcttatataacagacgaaggacttgagatgggacgggcacaggtg
atgcaggctgaggcagcaggcattaagcctatggtgtgcatgaatcctattcttttaaag
cctacaaataatacaggctcacaggtgattgtaaacggaagggtgcttaagaacatgccg
gcgagagagtattttgcatacaagaaaactctgataccggatataaaaaaggcatttaaa
aagcttgaggagtatgctgatatcatagtgattgagggcgcaggaagcccggcggagata
aatctgaaggaaaatgatattgtaaacatggggcttgcgcatatggtggatgcaccggtg
ctgctcgtgggtgatatcgacagaggtggcgtttttgcgcagctgcttggcacacttatg
cttttaaccgatgaggaaaagaatcgtgtctgcgggcttattatcaataaattccgtgga
gacaagacgatccttgacccggggatacagatgcttgaggagagaggtagggtgcctgtt
accggagtggtgccatatatggatgtacagcttgaggatgaggacagcctgacagagcgc
tttgacaaaaagacagatgggcttattgatatagcggtcatcagatatccgagaatatca
aatttcacggatttcaatgtctttgagcagatgtccgaggtaacagtacggtatgtgtca
acagtaaatgagctgcgtcatccggatatagtatttctgccgggaagcaagaatacgatg
ggggatcttttgtggatgagacaaaacggacttgaggccgctgtcaaaaagctttcctgt
gagattccggtttttggaatatgcggaggctatcagatgcttggggcttcaatagccgac
cccgacggtgttgaggagggaggatatatgcgtggcatggagcttcttcctatagatacc
gttctaaaagacagcaagacacggcttcagacaagcggtgaaatagcacatgtagatggg
gtattgagcaggctttcaggctgtcactttctgggctatgagatacatatgggtaagagc
gcatatagcacagcttcagatgagcagggggcttgtgctgacaggaaaaatgagttaaat
aatgtcatatctgatggcagaaatgtgtacggctcgtacatccacggcatttttgatact
gcagaggccgccagggtgatagtggattatattgccgataaaaagggcattgatgtgaat
gacagcgctattgtaagctataagagcttcaaagaaaaacagtatgacaggcttgcggac
acactgagggagtatctggatatggatgcagtgtacggcatgcttcgtgaggcaaaatat
gattga

DBGET integrated database retrieval system