KEGG   Eubacterium rectale ATCC 33656: EUBREC_1992Help
Entry
EUBREC_1992       CDS       T00909                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00260  Glycine, serine and threonine metabolism
ere00750  Vitamin B6 metabolism
ere01100  Metabolic pathways
ere01110  Biosynthesis of secondary metabolites
ere01120  Microbial metabolism in diverse environments
ere01230  Biosynthesis of amino acids
Module
ere_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EUBREC_1992
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EUBREC_1992
Enzymes [BR:ere01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EUBREC_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP COX6C
Motif
Other DBs
NCBI-ProteinID: ACR75733
UniProt: C4ZBK1
Position
complement(1880267..1881760)
Genome map
AA seq 497 aa AA seqDB search
MDLLYSSTRNSEKKITASQAILKGLADDGGLFVPESIPALDVSVEELSKMSYQQVAYEVM
KLFLTDFTEEELKNCINRAYDSKFDTTEIAPLKFADGAYYLELFHGSTIAFKDMALSILP
HLLITSAKKNNVKNEIVILTATSGDTGKAAMAGFADVEGTQIIVFYPKNGVSPIQEKQML
TQKGANTHVVGIHGNFDQAQSAVKAMFNDKALAETMDAAGYQFSSANSINIGRLVPQIVY
YVYAYSKLFAQRAVAKDEKINIVVPTGNFGNILAAFYAKNMGLPVAKLICASNENKVLYD
FFTTGEYDKNREFILTNSPSMDILISSNLERLIYRIAGNDANKNAQLMASLAKDGKYTVT
PEMKEKLSDFYGNYTSEKETAEVIKKLYEDTGYIIDTHTAVAAGVYDKYKEATGDTATKT
VIASTASPFKFTRSVMDAIDPKYDSMTDFELVDELSKLGNVKVPNAIEEIRDAKILHNTV
CDVDQMENTVKKMLGVQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggatttattatattcaagtacaagaaacagtgaaaagaaaataacagcttcacaggct
atccttaagggccttgccgatgacggaggattatttgtacctgagagcattccggcactt
gatgtttctgttgaggagctttctaagatgtcataccagcaggtagcatatgaggttatg
aagcttttccttacggatttcacagaggaagagcttaaaaattgtatcaacagggcatac
gacagcaagtttgatactactgagattgcaccgcttaagtttgctgacggggcttactac
cttgagttgttccatggctctacaatagccttcaaggatatggcattatccattctgcct
catttacttatcacatccgcaaagaaaaacaatgttaaaaacgagattgtcatcctgaca
gccacatcaggagacacaggaaaggcagctatggcaggttttgctgatgttgaggggaca
cagattatagttttctatccaaagaatggtgtcagcccgattcaggaaaagcagatgctt
acacaaaagggtgccaatactcatgtagtgggtattcacggcaactttgaccaggcacag
tcagcagtaaaggctatgttcaatgataaggctcttgcagagacgatggatgccgcgggc
tatcagttctcatctgccaactcaatcaatataggtcgccttgtaccacagattgtgtac
tatgtatatgcttactcaaagctttttgcacagagagctgtcgcaaaggatgagaagata
aatatcgttgttcctacgggaaactttggaaatatacttgcagcgttttatgcaaaaaat
atgggacttccagttgcaaagcttatctgcgcttcaaacgagaacaaggtgctttacgat
ttcttcacaacaggagagtatgataaaaacagagagtttatcctcacaaattcaccatcc
atggatattctcatttcttcaaaccttgagagactcatttaccgtatcgcaggaaatgat
gcaaataagaatgctcagcttatggcttcgcttgctaaggatggcaaatacactgtaaca
cctgagatgaaggaaaagctttctgacttctatggaaattacacaagtgagaaggaaacc
gctgaggttattaaaaagctttacgaggatacaggatacattattgatactcatacagca
gttgcagcaggtgtatatgacaagtataaggaggctacaggtgatacagccacaaagact
gttatcgcatctacagcaagtccattcaaattcacaagaagtgtgatggatgcaattgat
cctaagtacgattcaatgacagactttgagcttgtagatgagctttcaaagcttggcaac
gttaaggtaccaaatgccatcgaggaaatcagggatgcaaagattcttcacaacacagtc
tgtgatgtggatcagatggaaaacactgttaagaaaatgctcggtgtgcagtaa

DBGET integrated database retrieval system