KEGG   Eubacterium rectale ATCC 33656: EUBREC_2364Help
Entry
EUBREC_2364       CDS       T00909                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00260  Glycine, serine and threonine metabolism
ere01100  Metabolic pathways
ere01110  Biosynthesis of secondary metabolites
ere01120  Microbial metabolism in diverse environments
ere01130  Biosynthesis of antibiotics
ere01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ere00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EUBREC_2364
Enzymes [BR:ere01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     EUBREC_2364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACR76095
UniProt: C4ZEX4
Position
complement(2228122..2229156)
Genome map
AA seq 344 aa AA seqDB search
MIRFNNDYNRGAFDCILKALADTNTTSYPGYGEDEWCDKAEQIIKGLIGRDDSMIKFIPG
ATQANYVVVAAALSPVQSVIAADTGHINCHEAASIENTGHKILALPNTDGKISAAQIEAC
AAEYYDNAKPEYLTEPKMVYISFPTEQGTLYTKRELCDISAVCKKYGMYLFVDGARMGYG
LGSDKNDLTLCDFAMLSDVFYIGGTKCGALFGEALVINAEDIKYRFKAYMKQNGAVLAKG
WLMGLQFATMLENGDYFEKTKRADELAMQIKEAFEQKKVPFWVESFTNQQFVILSDEQKK
TLAEKYYFEEMEREKEGTVVRFCTSWATKQEEVDALVLDISKLV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgattagatttaataacgattataaccgcggtgcatttgattgcattttgaaggcactg
gcggatacaaatacaaccagctatccgggatatggtgaggatgagtggtgcgataaggct
gagcagattattaaggggcttattggcagagatgattccatgattaaatttattccgggt
gcgacacaggccaattatgttgtggttgcggcggcgctttcaccggtgcagagcgtgatt
gcagcggatacgggacatatcaattgccacgaggccgcttctattgagaatacaggtcat
aagattcttgcacttcctaacacggatggtaaaatcagtgctgcgcagattgaggcgtgt
gccgcagagtattatgacaatgcaaagcctgagtatctgacagagccaaagatggtttat
atttcatttcctactgagcagggtactctttacacgaaaagagagctttgcgatatcagt
gctgtctgcaagaaatacggcatgtacctgtttgttgatggtgcgagaatgggctatgga
ctgggctcagataaaaatgaccttacactttgtgattttgccatgctttcggatgttttt
tatatcggtggcacaaagtgtggtgcgctctttggcgaagcgctggttataaatgctgag
gatatcaagtatcgttttaaggcttatatgaagcaaaacggtgcagtgcttgcaaagggc
tggctgatgggcttgcagtttgccactatgcttgagaatggcgattattttgaaaagaca
aagcgtgctgatgagcttgccatgcagattaaagaggcatttgaacagaagaaggtaccg
ttttgggttgagagctttacaaatcagcagtttgtgattttatcggatgagcagaagaag
acacttgccgagaagtactattttgaagagatggaaagagaaaaagagggcactgtagtg
cgattctgcaccagctgggccacaaaacaggaggaggttgatgcactggttttagatata
tcaaagctggtgtag

DBGET integrated database retrieval system