KEGG   Eubacterium rectale ATCC 33656: EUBREC_2975Help
Entry
EUBREC_2975       CDS       T00909                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ere  Eubacterium rectale ATCC 33656
Pathway
ere00260  Glycine, serine and threonine metabolism
ere00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ere01100  Metabolic pathways
ere01110  Biosynthesis of secondary metabolites
ere01130  Biosynthesis of antibiotics
ere01230  Biosynthesis of amino acids
Module
ere_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ere00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EUBREC_2975
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EUBREC_2975
Enzymes [BR:ere01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EUBREC_2975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB HMGL-like BtpA
Motif
Other DBs
NCBI-ProteinID: ACR76703
UniProt: C4ZI66
Position
complement(2858083..2858850)
Genome map
AA seq 255 aa AA seqDB search
MNKIRSAFENGKAFIPFITCGDPNLETTEKIVREAVANGADLIELGIPFSDPTAEGPVIQ
GANIKALAAGVTTDKVFDLVRDLRKDVTIPMVFMTYANVVYSYGAEKFISTCKEIGIDGL
ILPDIPYEEKEEFLPLCEKYDVDLISFIAPTSKDRIAMIAKEATGFIYVISSLGVTGTRS
EIKTDLASIVKVIRENTDVPCAIGFGISTPKQAKKMADISDGAIVGSAIIKIIDEYGEAS
PKYVGEYVKAMKDAL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaataagataagaagtgcgtttgaaaacggcaaggcgtttataccatttatcacctgt
ggtgatccaaatttagagacaactgaaaaaatcgtaagagaagcagttgcaaacggagca
gaccttatagagctgggaattccattctctgatcctacagcagagggacctgtaatccag
ggcgccaacataaaggcacttgcagccggagttacaacagacaaggtttttgaccttgtg
agagatctgagaaaagatgtcacaattcctatggttttcatgacatatgcaaacgtggtt
tactcttacggcgcagaaaagtttatcagtacatgtaaggaaataggcattgacggactc
attctgccggatatcccatatgaggaaaaggaagagtttttaccactctgcgagaaatat
gatgtggaccttatttcatttatcgcacctacatcaaaggatcgcattgcgatgatagca
aaggaggcaaccggcttcatctatgtgatttcaagcctcggagtcaccggtacaagaagc
gagattaagacagatctggcttcaatagtcaaggtaatcagagaaaacacagatgtgcca
tgtgctatcggttttggcatttcaacacccaagcaggcaaagaagatggcagatatctcg
gatggtgccattgtgggctctgccatcatcaagataatcgatgagtatggtgaggcttca
ccaaagtatgtcggtgagtatgttaaagcaatgaaggatgcactgtag

DBGET integrated database retrieval system