KEGG   Ehrlichia ruminantium Gardel: ERGA_CDS_07830Help
Entry
ERGA_CDS_07830    CDS       T00232                                 

Gene name
pdhA
Definition
(GenBank) Pyruvate dehydrogenase E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
erg  Ehrlichia ruminantium Gardel
Pathway
erg00010  Glycolysis / Gluconeogenesis
erg00020  Citrate cycle (TCA cycle)
erg00620  Pyruvate metabolism
erg01100  Metabolic pathways
erg01110  Biosynthesis of secondary metabolites
erg01120  Microbial metabolism in diverse environments
erg01130  Biosynthesis of antibiotics
erg01200  Carbon metabolism
Module
erg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:erg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERGA_CDS_07830 (pdhA)
   00020 Citrate cycle (TCA cycle)
    ERGA_CDS_07830 (pdhA)
   00620 Pyruvate metabolism
    ERGA_CDS_07830 (pdhA)
Enzymes [BR:erg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     ERGA_CDS_07830 (pdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N Transketolase_N
Motif
Other DBs
NCBI-ProteinID: CAI28235
UniProt: Q5FGA5
Position
1253556..1254545
Genome map
AA seq 329 aa AA seqDB search
MTTDHIHNLTKQQLINCYHDMLLIRRFEEKSGQLYGMGLIGGFCHLYIGQEAIAVGIQHS
IIEGDSIITSYRDHGFMLSSGTDPKYVMAELMGKSTGCSGGKGGSMHMFNIEKQFFGGHG
IVGAQVPIGTGIALANKYKKNNNVVFTCFGDGATNQGQVYEAFNMAALWKLPVVYVIENN
EYAMGTSVSRSSYITDLYKKGESFGIPGYQIDGMDLFAVIKAATDAAAYCREQNGPILLE
MKTYRYRGHSMSDPAKYRSKEEVEKVKEEKDPLINLKNYMISNKIISEEDCNKYDKEIRN
IVKESVEFSQNSSEPAVNTLYTDVYKNTD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaccatatacacaacttgacaaagcaacaactaataaattgctatcatgac
atgttgctaatacgcagattcgaagaaaaatctggacagttatatggaatggggcttata
ggtggattctgtcacctgtatataggccaggaagcaatagcagttggtatacaacattca
ataatagaaggagattctatcattactagttatagagatcatggttttatgctttcttct
ggtaccgatccaaaatatgtaatggcagaacttatgggcaaaagtaccggatgttcagga
ggtaaaggtggctctatgcatatgttcaacatagaaaaacaattctttggaggacatggt
atcgtaggtgcacaagttcctataggtacaggaattgctcttgctaacaaatacaaaaaa
aataacaacgtggtttttacatgctttggagatggagctactaaccaaggacaagtatat
gaagcttttaatatggctgcactctggaaattaccagtagtatatgttattgagaataat
gaatatgcaatgggtacatcagtatctagatcatcttatattacagatttatataaaaaa
ggagaaagttttggtataccaggatatcaaatagatggaatggatttatttgcagtaata
aaagcagcaactgatgcagcagcttattgcagagaacaaaacggacctattttattagag
atgaagacataccgctacagaggacattctatgtcagatccagcaaaatatagatcaaaa
gaagaagtggaaaaagtgaaagaagaaaaagacccattgataaacttaaaaaattatatg
atatccaacaaaatcatatccgaagaggattgcaataaatatgataaagaaattcgcaat
atcgtaaaagaatctgtagaattttctcaaaacagtagcgaaccagcagtaaatacatta
tatactgatgtatataaaaacacagattaa

DBGET integrated database retrieval system