KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0457Help
Entry
ERH_0457          CDS       T01525                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
erh00010  Glycolysis / Gluconeogenesis
erh00260  Glycine, serine and threonine metabolism
erh00680  Methane metabolism
erh01100  Metabolic pathways
erh01110  Biosynthesis of secondary metabolites
erh01120  Microbial metabolism in diverse environments
erh01130  Biosynthesis of antibiotics
erh01200  Carbon metabolism
erh01230  Biosynthesis of amino acids
Module
erh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
erh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERH_0457 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ERH_0457 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ERH_0457 (gpmA)
Enzymes [BR:erh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ERH_0457 (gpmA)
Membrane trafficking [BR:erh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ERH_0457 (gpmA)
Exosome [BR:erh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ERH_0457 (gpmA)
  Exosomal proteins of melanoma cells
   ERH_0457 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAK31514
UniProt: F5WRY2
Position
complement(500086..500835)
Genome map
AA seq 249 aa AA seqDB search
MMKLVVVRHGESEWNEKNLFTGWADVELSEKGVEEAKLGGRMLKEEGYDFDIVYTSYLKR
AIHTMDNILNEMERTWLPIVKDWRLNERHYGALQGLDKAETAAKYGEDQVLIWRRSFDVK
PPELDPTDERAPRNMEAYRNVEDKDILPLHESLKETIERAVPYFEETIKPQMLDGKRVLI
VAHGNSLRSLVKYFDNMTDDEIMKVNIPTGVPLVYEFDNDFNVVNKYYLGDQEALKAKME
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagttgtagttcgtcacggtgaaagtgaatggaacgaaaagaacctcttt
actggatgggctgatgtagaactttcagaaaaaggtgtagaagaagctaaacttggtgga
cgtatgcttaaagaagaaggttacgatttcgatatcgtttatacttcatacttaaaacgt
gcaatccacactatggacaatattttaaatgaaatggaacgtacatggttaccaatcgtt
aaagattggagacttaacgaacgtcactacggtgcgttacaaggtttagataaagctgaa
acagctgcgaaatatggtgaagaccaagttcttatttggagacgttcatttgacgttaaa
cctccagaattagatcctactgacgaacgtgctccacgtaacatggaagcataccgtaat
gtagaagataaagatatcttaccattacacgaatccttaaaagaaacaattgaacgtgct
gttccttattttgaagaaacaattaaacctcaaatgttagatggaaaacgtgttcttatt
gttgctcatggtaactcattacgttcacttgttaaatattttgacaatatgactgatgat
gaaattatgaaggtaaacatccctacaggtgttcctttggtttatgaatttgataacgac
ttcaatgttgtaaacaaatactacctcggtgaccaagaagcacttaaagctaaaatggaa
gcagtcgcaaaccaaggaaaagctaaataa

DBGET integrated database retrieval system