KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0530Help
Entry
ERH_0530          CDS       T01525                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
erh00471  D-Glutamine and D-glutamate metabolism
erh00550  Peptidoglycan biosynthesis
erh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ERH_0530 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ERH_0530 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:erh01011]
    ERH_0530 (murD)
Enzymes [BR:erh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     ERH_0530 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:erh01011]
 Precursor biosynthesis
  Amino acid ligase
   ERH_0530 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: BAK31587
Position
573893..575167
Genome map
AA seq 424 aa AA seqDB search
MKALIIGGARSGIGCARLLHKEGFEVVLTTNQDFPERHELESLGIHVSLDDKDMSLLGTY
DFVIKNPGIPNDHPLVSQFPNIYNEIEIASRFANHAKFYAISGTNGKTTTTTCLHEMLLK
KDSAALLAGNVGYALSEAIYRDGDLTRDVALEISAFQMEGTPSFSPEVYALMNLSPDHMD
RYDEVDDYYKAKLNILSNVKTFIRNCDDQNIMRLTQDYQGKVYDLSMTHDADICLREGWV
YFLDNPLFEVSSLKLVGKHNLMNAAFAASLAFLAGVKLSDIREVIQTFSGVEHRIEFVDE
VDGVRYYNDSKATNPESTEVCLQAFEKPIILLAGGFDKHISFDLLKPYDNRIKILFVFGE
SADQIREVFPFAIKVDTMKTAFVEAKSQASSGDIIVLSPACASYDQFENFEIRGNIFKEY
VKTL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttaattatcggaggagcacgttcaggaattggatgtgctcgtcttcttcat
aaagagggttttgaagtagtattgacgacaaatcaagactttccagaacgtcatgaactt
gaatcattagggattcatgtatctttggatgataaagatatgagtcttctaggtacatat
gattttgtgataaaaaatccaggaatacccaatgaccatccgctcgtttctcaatttcca
aacatttataatgaaattgaaattgcgtctcgtttcgcaaatcatgcgaaattttatgca
atttcaggaacgaatgggaaaacaactacaacaacatgtctccatgaaatgttattgaaa
aaagattcagctgcgcttcttgcggggaatgtgggctatgcactgagtgaagccatttat
cgcgatggggatctaacgcgtgatgttgctttagagatttctgcatttcaaatggaaggc
acgccgtcattttcaccggaagtgtatgcgcttatgaatttaagtccagatcacatggat
cgttatgacgaagttgatgactattacaaagctaagttaaacatattatcgaatgttaaa
acattcattcgaaattgtgatgatcaaaacatcatgcgtttgacgcaagattatcaaggc
aaggtttatgatttatccatgactcacgacgccgatatttgtctgcgtgagggttgggtc
tattttcttgataatccactttttgaagtatcttcattaaaacttgtcggtaagcataat
ttaatgaacgctgcctttgccgcaagccttgcatttcttgcaggtgttaagctttcagat
attcgagaggtaatccagacctttagtggtgttgaacatcgcatcgaatttgtggatgaa
gtggatggcgttcgctactacaacgattccaaggcaacaaaccctgaatctacggaagtt
tgtcttcaagcttttgagaagccaattatcttactcgcagggggtttcgataaacatatt
tcttttgatttacttaaaccttatgacaatcgcattaaaatactgtttgtatttggagaa
agtgctgatcaaattcgtgaagtatttcctttcgcaattaaagttgataccatgaaaact
gcttttgtcgaagcaaaatcacaggcatcatccggtgatatcattgtgttgtcgccagca
tgtgcaagttatgatcaatttgaaaattttgaaattcgtggtaacatatttaaagaatac
gttaaaactctctag

DBGET integrated database retrieval system