KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_1009Help
Entry
ERH_1009          CDS       T01525                                 

Gene name
glk.2
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
erh00010  Glycolysis / Gluconeogenesis
erh00052  Galactose metabolism
erh00500  Starch and sucrose metabolism
erh00520  Amino sugar and nucleotide sugar metabolism
erh00521  Streptomycin biosynthesis
erh01100  Metabolic pathways
erh01110  Biosynthesis of secondary metabolites
erh01120  Microbial metabolism in diverse environments
erh01130  Biosynthesis of antibiotics
erh01200  Carbon metabolism
Module
erh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERH_1009 (glk.2)
   00052 Galactose metabolism
    ERH_1009 (glk.2)
   00500 Starch and sucrose metabolism
    ERH_1009 (glk.2)
   00520 Amino sugar and nucleotide sugar metabolism
    ERH_1009 (glk.2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ERH_1009 (glk.2)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ERH_1009 (glk.2)
Enzymes [BR:erh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ERH_1009 (glk.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: BAK32064
UniProt: F5WTI2
Position
complement(1067055..1067969)
Genome map
AA seq 304 aa AA seqDB search
MNKYIGVDLGGTNVRVAVIDEDGKIHEQVKSESYALEGPEVVLDNIISMIKNLKQFDECV
GIGLGLPGPVNTELGCVTLSTNMKGFTEYPVIDYLKKHIDLPIYMDNDANVAGLAEALVG
AGKGNNVVYYLTHSTGIGGALVFNGQVLSGHKGYAGEVGNIVIDRERVRRSDINTLNAGA
VENEASGSALVRKAQELIDPKIQSAEEIFTLMEQGNEQAIQLIDEMSYDFAMMLSSIAHV
CNPHVFVIGGGVTKSKNLYWDRMIGYYQELVHEQMRDTQFVEAKLDEPGVIGAAMLCYSK
EGHR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatatatcggagttgatttaggcggtacaaatgtacgtgtggctgttattgat
gaagatggaaagattcatgagcaagttaagagcgaatcatacgcacttgagggacctgaa
gttgttttagataatatcatttcgatgataaaaaatttaaagcaatttgatgaatgtgtt
ggaattggactgggtttacccggtccagtgaacacagaactcgggtgcgtaaccttatct
acaaacatgaaagggtttacggagtatccggtaatcgattatctcaaaaagcatatagat
ttaccaatctatatggataatgatgcaaacgttgcaggtcttgctgaagcactcgttggt
gcaggtaaaggcaataatgttgtgtattatttaacgcattctacaggtattgggggagca
cttgtatttaatggacaagtgctttctggtcacaaggggtatgcgggggaagtcggtaat
atcgtgattgatcgtgaacgtgttcgacggtcggacattaatactttaaatgcgggtgcg
gttgaaaatgaagcaagtggttcggcattagttcgtaaagctcaagaattgattgatcca
aagattcagtctgcagaagaaattttcactttaatggaacaaggaaatgaacaggcaatt
caactaattgatgaaatgtcctacgatttcgctatgatgctctcttcaattgcgcatgta
tgtaatccacatgtttttgtaattggtggtggtgttacgaaatcaaaaaacttatattgg
gaccgtatgatcggttattatcaggaactcgttcatgaacaaatgagagatacacaattt
gttgaagcgaagttggatgaacctggtgtaattggtgcggcgatgttgtgttactcgaaa
gaaggtcacagataa

DBGET integrated database retrieval system