KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_1639Help
Entry
ERH_1639          CDS       T01525                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
erh00071  Fatty acid degradation
erh00072  Synthesis and degradation of ketone bodies
erh00280  Valine, leucine and isoleucine degradation
erh00310  Lysine degradation
erh00362  Benzoate degradation
erh00380  Tryptophan metabolism
erh00620  Pyruvate metabolism
erh00630  Glyoxylate and dicarboxylate metabolism
erh00640  Propanoate metabolism
erh00650  Butanoate metabolism
erh00900  Terpenoid backbone biosynthesis
erh01100  Metabolic pathways
erh01110  Biosynthesis of secondary metabolites
erh01120  Microbial metabolism in diverse environments
erh01130  Biosynthesis of antibiotics
erh01200  Carbon metabolism
erh01212  Fatty acid metabolism
erh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:erh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERH_1639 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    ERH_1639 (atoB)
   00640 Propanoate metabolism
    ERH_1639 (atoB)
   00650 Butanoate metabolism
    ERH_1639 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ERH_1639 (atoB)
   00072 Synthesis and degradation of ketone bodies
    ERH_1639 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ERH_1639 (atoB)
   00310 Lysine degradation
    ERH_1639 (atoB)
   00380 Tryptophan metabolism
    ERH_1639 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ERH_1639 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ERH_1639 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ERH_1639 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:erh04147]
    ERH_1639 (atoB)
Enzymes [BR:erh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ERH_1639 (atoB)
Exosome [BR:erh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ERH_1639 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: BAK32691
UniProt: F5WVA9
Position
complement(1717362..1718540)
Genome map
AA seq 392 aa AA seqDB search
MRDVVIVSAARTAIGKFGGSFLKTSAVELGTAVIKEAIHRAKISPEDVEYVVMGNVIQTG
LGQNPARQASVFSGIPYSTPAMTINEMCGSGMKSIHLGMQSIMLGEKDVVVVGGFENMSQ
APHIIKNGRFGSKFQNLETEDTIQKDGFVDAFTNELMGVTAEKVAEQFNISREDQDAFAL
ESQMRATRALEAGLFKDEIVPVNNGRDLIDTDEFIRTNSTLEGLQRLKPSFKLDGTVTAG
NASGVNDGAAALVLMSREKAEAMNLDIIATIKGFSEVGVDPEIMGYAPFYAVKSLAEKTN
TDLNTVDRFELNEAFASQSLAVCRDLNLDLNKVNVNGGAISIGHPIGASGARIMVTLIYE
LIHSDTKRGIASLCIGGGMGVAMMIEREEPTK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagacgtagttatagtcagtgctgcgcgcactgcgataggtaaattcgggggaagc
ttcttgaagacttcagctgtagaattaggaactgcagtgattaaagaagcgattcatcgt
gcaaagatttcgccggaagatgttgaatacgtagtaatgggtaatgtcatccaaactgga
ttaggacaaaaccctgcgcgacaagcatcggtgttttctggaattccctattcaacacca
gccatgacaattaatgagatgtgcggttcggggatgaagtcaattcatcttggaatgcaa
tccattatgcttggtgagaaggatgttgtagtagtgggtggttttgaaaatatgtcgcaa
gcacctcatataataaagaatggtcgctttggttcgaaatttcaaaacttggaaacagaa
gatacaattcaaaaagatggttttgttgacgcgtttaccaatgaattgatgggtgttaca
gcggaaaaagtcgctgaacaatttaatatatcccgtgaggatcaagatgcgtttgcttta
gaatcacaaatgcgtgcaacacgtgctcttgaggcaggactttttaaagatgaaattgtt
ccagttaataatggacgtgatcttatcgatacggatgagtttatcagaacaaattctacg
cttgaaggacttcaacgtttaaaaccaagttttaaacttgatggaacggttacagcgggt
aatgcttctggggttaatgatggtgctgctgcacttgtattaatgagtcgtgaaaaggca
gaggcaatgaatttagatattattgctaccattaaaggcttctcggaagtaggcgttgat
cctgaaattatgggttatgcacctttctatgcagttaaatccttagcagagaaaacaaat
acagatttaaatacagttgatcgatttgaattaaacgaagcttttgcttcacaatcgtta
gcggtatgtagagatttaaatttagatttaaataaagtgaatgttaatgggggagcgatc
tcaattgggcatccaattggtgcatcgggcgctcgtattatggttactttaatttatgaa
ttaattcattcagatacaaaacgtggtattgcttcgttatgtattggtggcggcatgggt
gtcgcaatgatgattgaacgagaagaacctacgaagtag

DBGET integrated database retrieval system