KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_1664Help
Entry
ERH_1664          CDS       T01525                                 

Gene name
aldH
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
erh00010  Glycolysis / Gluconeogenesis
erh00053  Ascorbate and aldarate metabolism
erh00071  Fatty acid degradation
erh00280  Valine, leucine and isoleucine degradation
erh00310  Lysine degradation
erh00330  Arginine and proline metabolism
erh00380  Tryptophan metabolism
erh00561  Glycerolipid metabolism
erh00620  Pyruvate metabolism
erh00625  Chloroalkane and chloroalkene degradation
erh01100  Metabolic pathways
erh01110  Biosynthesis of secondary metabolites
erh01120  Microbial metabolism in diverse environments
erh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:erh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERH_1664 (aldH)
   00053 Ascorbate and aldarate metabolism
    ERH_1664 (aldH)
   00620 Pyruvate metabolism
    ERH_1664 (aldH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ERH_1664 (aldH)
   00561 Glycerolipid metabolism
    ERH_1664 (aldH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ERH_1664 (aldH)
   00310 Lysine degradation
    ERH_1664 (aldH)
   00330 Arginine and proline metabolism
    ERH_1664 (aldH)
   00340 Histidine metabolism
    ERH_1664 (aldH)
   00380 Tryptophan metabolism
    ERH_1664 (aldH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ERH_1664 (aldH)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ERH_1664 (aldH)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ERH_1664 (aldH)
Enzymes [BR:erh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ERH_1664 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAK32716
Position
complement(1742573..1743931)
Genome map
AA seq 452 aa AA seqDB search
MNRLDKQKKYFNSQITKPIAFRKEALDKLEKGLKAYETKIYAAFKQDLSKPEMEVYTTEI
AVVYRSIRDAKKNLRQWMKQQKVKTPFVLAGRKSFKLYEPLGNTLIIGPFNYPLQLVLVP
LVGAIAAGNTAVIKTSELTPAISSVIHELISDFFIEDYIVVVEGDVSVNQELLKQPFDFI
FFTGSTQVGKIVMKYAAENLTPVVLELGGKSPCVVTENANISLSAKRIAWGKFLNNGQTC
VAPDYVLVSRKHEEALTQALIKEIRAMYGDDIKNNEDYGRIVNIKHADRLKQILEAHKDD
IVFGGRSNGTYIEPTLLSLECDKGKVMESEIFGPILPIIAFDTLEEAYTIIENNPKPLSL
YMFTESYEEQEAILNRIQFGGGCINDTILHLVNDALPFGGIGNSGIGTYHGFSSFEVFSN
CKSMMKSNSFPLSIMYPPYHQTKFKFIKKIFK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgattagataagcaaaaaaaatattttaattcacagattacaaaaccaatagca
ttcagaaaagaagcattagataaactcgaaaaagggctgaaagcttatgaaacaaagatc
tacgcagcgtttaaacaagacctgtctaaacctgaaatggaggtatacacaacagaaatt
gcagttgtatatcgatcgattcgtgatgcgaaaaaaaatcttagacaatggatgaaacaa
caaaaagtcaaaacaccttttgttctcgcaggaagaaagagctttaaactttatgaacct
ttgggaaatacattgatcatcggtccttttaattatcctttacaacttgtccttgttcca
cttgtaggggctatcgcagcaggtaatacggctgttatcaagacatcagagctaacacct
gctatctcaagtgttattcatgaattgatttctgattttttcatcgaagattacattgtg
gtcgtagagggggatgtatccgtaaatcaagaacttctcaaacaaccttttgatttcatt
ttcttcaccggaagcacacaagtagggaaaattgttatgaaatatgccgcagaaaatcta
acaccagtggttcttgaactcggtggaaaaagtccatgtgtagtaaccgaaaatgcaaat
atttcactaagtgcaaaacgtattgcttgggggaaatttcttaataatgggcagacctgt
gtggcaccagactatgttttagtttcacgaaagcatgaagaggcattgactcaagcactt
atcaaggaaataagagccatgtatggcgatgatatcaaaaacaatgaagactatggccgt
atcgtgaatataaagcacgcagaccgcctcaaacagatcctggaggcacataaagatgat
attgtctttggaggcaggagtaatggaacatatatcgaaccgacgttactctctttagag
tgtgataagggtaaggttatggaatctgaaatatttggaccgatcttaccgataattgca
tttgatacattggaagaggcctatacaataattgaaaataatccaaaacctctatcctta
tatatgttcacagagtcctatgaagaacaagaagcaattcttaatcgtattcaatttggt
ggcggatgcattaatgatacaatattgcatcttgtaaatgacgcacttccttttggtggg
attggaaattctggaattggaacatatcatggtttttcaagttttgaagtcttttcaaat
tgtaaatcaatgatgaaatcaaattcatttccgctatcgataatgtacccaccttatcat
cagaccaaatttaagttcatcaaaaaaatatttaaataa

DBGET integrated database retrieval system