KEGG   Erwinia sp. Ejp617: EJP617_02970Help
Entry
EJP617_02970      CDS       T01935                                 

Gene name
vraB
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00071  Fatty acid degradation
erj00280  Valine, leucine and isoleucine degradation
erj00310  Lysine degradation
erj00362  Benzoate degradation
erj00380  Tryptophan metabolism
erj00620  Pyruvate metabolism
erj00630  Glyoxylate and dicarboxylate metabolism
erj00640  Propanoate metabolism
erj00650  Butanoate metabolism
erj00900  Terpenoid backbone biosynthesis
erj01100  Metabolic pathways
erj01110  Biosynthesis of secondary metabolites
erj01120  Microbial metabolism in diverse environments
erj01130  Biosynthesis of antibiotics
erj01200  Carbon metabolism
erj01212  Fatty acid metabolism
erj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:erj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EJP617_02970 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    EJP617_02970 (vraB)
   00640 Propanoate metabolism
    EJP617_02970 (vraB)
   00650 Butanoate metabolism
    EJP617_02970 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EJP617_02970 (vraB)
   00072 Synthesis and degradation of ketone bodies
    EJP617_02970 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EJP617_02970 (vraB)
   00310 Lysine degradation
    EJP617_02970 (vraB)
   00380 Tryptophan metabolism
    EJP617_02970 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EJP617_02970 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EJP617_02970 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EJP617_02970 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:erj04147]
    EJP617_02970 (vraB)
Enzymes [BR:erj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EJP617_02970 (vraB)
Exosome [BR:erj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EJP617_02970 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADP09978
UniProt: E3DDH3
Position
complement(322007..323203)
Genome map
AA seq 398 aa AA seqDB search
MAAIQSLLNYQPEDDRQPVIVAARRTPVGRAYGSLASVSPEALLAPLFNPLLPAGMTAID
EVIIGNATGGGGNIARLAALAAGVPMTVPAVTVDRQCGSGLEAVINACRLVQARAGECYL
AGGVESVSNAPWRVEKPATLKQMPRFYPRARFSPDEIGDPEMGIAAENVARQYAISRERQ
DRFALRSHQRALAAAQQGAFREEIVPLNLGHCLVENDECPRPGTSLAQLAALPPVFAADG
SVTAGNCCPLNDGAALLLVMSRRMARDYGFTQGLLFADACSAGVDPNLLGLGPVPATEKL
LRRQPGLTLDGVEVIEFNEAFAAQVLASVDALGIDEHRINQQGGAIALGHPYGASGAIMV
TRLFSQLVSQRQSEGYGLAMLGIAGGLGLSALFKGVQL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagctatacagagcttactgaattatcagcctgaggatgaccggcagccggtgatt
gtggccgcccgccgtactcctgtcggcagggcttatggttctctggccagcgtgtcgccg
gaggcgctgctggccccgctgtttaacccgctgctgccagcaggcatgacggcgattgat
gaggtgattatcggcaacgccaccggcggcggcggcaatattgcgcggctggcggcgctg
gcggcgggcgtgccgatgaccgtgcctgccgtaacggtggacaggcagtgcggctcgggg
ctggaagcggtgatcaacgcctgtcggctggtgcaggccagggcgggcgaatgctatctg
gccggcggcgtggagagcgtcagcaacgcgccctggcgggtggagaagcccgccacgcta
aagcagatgccgcgcttttaccctcgtgcacgtttttcaccggatgagatcggcgatccg
gaaatgggcattgccgccgaaaacgtcgcgcgccagtatgctatcagccgggaacgccag
gatcgctttgcgctgcgcagccaccagcgtgcgctggccgccgcgcagcagggcgcattc
cgtgaggagatcgtcccgcttaacctgggccattgcctggtcgaaaatgacgagtgcccg
cgccccggcacctcgctggcgcagctggcggcattaccgccggtatttgccgccgatggc
tcggtgacggcgggtaactgctgtccgctgaatgacggggctgcgctgctgctggtgatg
agccgccgcatggcgcgggattatggcttcacccagggtctgctgtttgccgatgcctgt
agcgcaggcgttgacccgaatttactcggcctcggcccggttcccgccacggaaaaactg
ctgcggcgtcagccgggcctgacgctggacggggttgaggtcattgagttcaatgaagcc
tttgctgcccaggtgctggcatcggttgatgcactgggtatagatgaacacaggatcaac
cagcaggggggcgctattgctttggggcatccgtacggcgcttccggggcgataatggtg
acgcggctgttcagccagctggtcagccagcggcagagcgaaggctacggcctggcgatg
ctgggaatagctggcgggctggggctgagcgcattgtttaagggcgtgcagctgtaa

DBGET integrated database retrieval system