KEGG   Erwinia sp. Ejp617: EJP617_04500
Entry
EJP617_04500      CDS       T01935                                 

Gene name
vgrG2
Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
erj  Erwinia sp. Ejp617
Pathway
erj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:erj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EJP617_04500 (vgrG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:erj02044]
    EJP617_04500 (vgrG2)
Secretion system [BR:erj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EJP617_04500 (vgrG2)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF2345
Other DBs
NCBI-ProteinID: ADP10131
UniProt: E3DES8
Position
complement(497104..499032)
AA seq 642 aa
MFDRITVQLPMDGLLFWRMSGREALSQSFELSVQLLSTDARIERRALLGQPITVCIPTQG
IMSTRYLNGKITKVSVSSQELSGTRYAVYTLVMEPDLWPLKRDKNLRIFQGQTVPQIVKT
LLGEYNVALEDRLTGSYRSWEYCVQYQESSFNFISRLMELEGIYYYFRHEADGHRLVLMD
AAQQHQPFSGYEAIPYHVTPSGGSTSEEGIGLWSLEDSVTPGMYSIDDYDFRKPNAWMLQ
ARQNPASPQPGAIDVYDWPGHFVDHDHGEFYARIRQEVWQAEHQQISAAGTALGLAPGNT
FTVLNAPFISDNGEYLTTEAHYDFEENQYASGDGGGGTKHNIAIRVIPSGVTFRAPPGTP
WPRTHGPQTAKVVGPKGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDN
ANALRFEDKAGEEQVWIQAERNMDTQVKNDASHSVGKNHSHYVGESELHRVETDRVHGIK
GGEQLLTGKGKSDAAAEAYVIGSGTTLRLECGESVIELTASGQINIVGKGFNFCVEQDGF
INTGGKLNINDGTGAATAAPGSSHKANITRAVEALFPTKKGE
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgtttgaccgtatcaccgtacagctgccgatggacggcctgctgttctggcgcatgagc
gggcgcgaagcgctgtcgcagtcatttgaactgagcgtgcagctgttaagcaccgacgcg
cgcattgagcgcagggcgctgctcggccagccgatcaccgtttgcatccccacccagggc
ataatgagcacgcgctatctgaacggcaaaatcaccaaagtttcggtcagcagccaggag
ctgagcggcacgcgctacgcggtgtacaccttggtaatggagccggacctgtggccgctg
aagcgcgacaaaaatctgcgcattttccaggggcagacggtgccgcagatcgtcaaaacc
ctgctgggtgagtacaacgtggcgctggaagaccgtctgaccggcagctaccgcagctgg
gagtactgcgtgcagtaccaggaaagcagctttaactttatcagccggctgatggagctg
gaggggatctactactacttccgccacgaggcggacgggcacaggctggtgctgatggac
gcggcgcagcagcatcagccgttcagcggctatgaggcgatcccttaccacgtcacgccg
tccggcggcagcaccagtgaagagggcatcgggctgtggtcactggaggacagcgtgacg
ccggggatgtacagcatcgacgactacgacttccgcaaaccgaacgcatggatgctgcag
gcgcggcagaatccggcctcgccgcagccgggtgccatcgacgtttacgactggccgggg
cattttgttgaccacgaccacggcgaattctatgcgcgcatccgccaggaagtgtggcag
gcagagcaccagcagattagcgccgccggcaccgcgctggggctggcgccgggcaacacc
tttacggtgctgaacgcgccgtttatcagcgataacggcgagtacctgaccacggaggcg
cactacgattttgaagagaaccagtacgccagcggtgacggtggtggcggaacaaaacac
aatatcgccatccgcgtaatcccctccggcgtgaccttccgcgcgccaccgggaacgccg
tggccgcgcacccacgggccgcagacggcgaaggtggtggggccgaagggcgagtcgatc
tggaccgataaatatggccgcatcaaagtgaaatttcactgggaccggctggcaaaaggt
gacgataccagctcgtgctgggtacgcgtctccagcgcctgggcaggccagggctatggc
ggggtgcagatcccgcgcgtgggcgacgaggtggttgtcgactttatcaacggcgacccg
gaccggccaatcatcaccggtcgcgtatacaacgaggcgagtatgccgccgtgggcgctg
cccgccgccgcgacgcagatgggctttatgagccgctcaaaagacggcacgccggacaac
gccaacgcgctgcgctttgaggataaggcgggcgaggagcaggtgtggatccaggccgag
cgcaatatggatacccaggtgaagaatgatgccagccacagcgtgggtaaaaatcacagt
cattacgttggagaaagtgagctgcaccgggtagagaccgatcgcgtgcacggcattaag
ggcggcgaacagctgctgaccggcaaagggaaaagcgatgcggcggcagaagcctatgta
ataggttccggcaccacgctgcgcctggagtgtggtgaaagcgtcattgaactgaccgcc
agcgggcagatcaatattgtcggcaagggctttaatttctgtgtagaacaggacggtttt
atcaataccggcggtaagctgaatattaatgatggtacgggggcagccaccgccgcaccg
ggttcatcccataaagccaatattacccgtgccgtggaagcgctgttcccgacaaaaaaa
ggggagtaa

DBGET integrated database retrieval system