KEGG   Erwinia sp. Ejp617: EJP617_04810
Entry
EJP617_04810      CDS       T01935                                 

Definition
(GenBank) Type VI secretion system, IcmF protein
  KO
K11891  type VI secretion system protein ImpL
Organism
erj  Erwinia sp. Ejp617
Pathway
erj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:erj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EJP617_04810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:erj02044]
    EJP617_04810
Secretion system [BR:erj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EJP617_04810
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: ADP10162
UniProt: E3DEV9
Position
complement(528597..532229)
AA seq 1210 aa
MLNMLFAVLTHRLLWGFVGITALSFIIWVIGPVFSIVDSRPLEPEVNRQISIGLLYLVWA
LGNLVPRLYNAWLNRKLMGSLKTTPGEQPGGDNPRLTSEDRVLAERFNEASELLKKAHFS
HAAGRRSPFWAQRFSRQYLYQLPWYVIIGAPGAGKTTALVNSGLQFPLADRFGKSALRGI
GGTRNCDWWFTNEAVLLDTAGRYTTQESQQQQDAGEWHGFINLLRKYRGRQPINGVIVTV
SVSDLLTQSAEAAQQQAVALRQRLTELHEQLGIRFPVYVLVTKADLLKGFRAYFAKFDKV
QREQIWGFTFPWERAKMSDFDLQAAFSQEYARLQQRLDAGLPDTLLQESDGQARAESFLF
PQEFAALRPLLAEYLDRVFARSDFETQFSPRGIYFASGTQEGLPFDRVMGELNRALQLPQ
QDAASGQSGSWDQTSKDAPIPGNKGQSFFLTDVLQKVIFPESGLAGSNRWWELRNRALLW
SGYIALAAALVISALLWFTSYGNNKSYLQQVQARVPEVVRQSSALQGSEQGDLFALLPFL
NSLLTLPESSEFDLNSPPISRRMGLYRGAEVSDATQALYQKSLKQLLLPQVAQLITGWLR
NDNGSDADYSYEALKAYQMLYQPPHYDGKFLHAWLMLNLQRTLPQNVTQAQLKQLEWHLS
QLLENQIQASPYARDDALVKREQALINQMPLSQRVWGRLKRLLEHDESLKAVSLASLGGP
QSELVFSRKSGRSIADGIPGLFTPAGYWQSFDKHIAAVTAALHDDDRWVLGAQSAGESQQ
QTDAAVRQLYIGDYIRQWDGLLQDIQLNNSADLAQRINSARLLSGNNSPLRKLVMNLSHY
LVLEKLPTDEKQAGKEKDAEADNSATRTLQALFRSRQNSTAATAEQTPEQAVANHFAPVI
ELAKPLEQGGKTIAFDDFIRQIDDLYRYLTAVQDAANSGMPPPAGDAISHLQASAGRLPG
SLQTLFSMLAVGASSDAQRRELENVRKRISSEVGGFCRQAIAGRYPLVRSARSEVTPDDL
ARMFAPGSGLMDSFFRDNLANKVDTTQSAWRFTPGIDGKSIGGEDILRPFQQAQSIRDAF
FANGATTPAFRVTVRTLRMDNEILNLTLDVDGQLLRYSHGPQAVQLMNWPGSGGTNQVRM
QLGLVDGTTSTLVTNGVWALNRFFDRAQLAPGSSSLSRQASFNVDGHRVTLEFTPNSIRN
PFQLSGFACP
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgttgaatatgctgtttgccgttttaacccaccgcctgctgtggggctttgtcggtatc
accgcgctgtcgtttattatctgggtgattggtccggtattttcgatagtcgactcgcgc
ccgctggagcctgaagtcaaccgccagatcagtatcggcctgctctatctggtgtgggcg
ctgggtaacctggtgccgcgcctgtataacgcctggctgaaccgcaagctgatgggcagc
ctgaaaaccacccctggcgaacagccgggcggtgataatccgcgtctgaccagtgaagat
cgggtactggcggagcgttttaatgaagcctccgagctgctgaaaaaagcacatttctcc
catgctgctggccgccgttcgccgttctgggcgcagcgcttcagccgtcagtatctttat
cagctgccgtggtatgtgattatcggcgcgccgggagccgggaaaaccaccgcgctggtc
aactccgggctgcagttcccgctggccgaccgctttggcaaatccgcgctgcgcggcatt
ggcggcacgcgcaactgcgactggtggtttaccaatgaagcggtgctgctcgataccgcc
gggcgctacaccacccaggagagtcagcagcagcaggatgccggagaatggcacggcttc
attaacctgctgcgcaaatatcgtggtcgccagccgatcaacggcgtgattgtcaccgtc
agcgtctccgatctgttaactcagtcggccgaggccgcgcagcagcaagcggtggcgctg
cgccagcgcctgaccgaactgcatgaacagctgggcattcgtttcccggtttacgtgctg
gtcaccaaagccgatctgctgaaaggcttccgcgcctacttcgccaaattcgacaaggtc
cagcgcgaacagatctggggtttcaccttcccgtgggaacgggcgaagatgagcgatttt
gacctgcaggcggcgttcagccaggagtacgcccggctgcaacagcggctggatgccgga
ttgccggacaccctgctgcaggagagcgatggccaggcgcgtgccgaaagttttctcttt
ccgcaagaatttgccgcgctgcgcccgctgctggcggaatacctggacagggtgtttgcc
cgctcagactttgagacccagttctcaccgcgcggcatctattttgccagcggcacccag
gaagggctgccgtttgaccgggttatgggcgagcttaaccgcgccttacagctgccgcaa
caggatgcggccagcggccagagcggcagctgggaccagaccagtaaagacgcgccgatc
cccggcaacaaggggcagagcttcttcctgacggacgtgctgcaaaaagtgattttcccc
gagtccgggctggcgggcagcaaccgctggtgggagctgcgcaaccgggcgctgctgtgg
tcaggctatatcgccctcgccgccgcgctggtgattagcgcgttgctgtggtttaccagc
tatggcaataacaaaagctatctgcagcaggtgcaggcgcgggtgccggaagtggtgcgg
caaagcagcgcgctacagggcagcgagcagggcgatctgtttgcactgctgccgttcctc
aacagcctgctgacgctgccggaaagcagcgaatttgacctgaactcaccgccgataagc
cgccgtatggggctgtatcgcggagccgaggtcagcgatgccacccaggcgctgtaccag
aaatcgctgaagcagctgctgctgccgcaggtggcgcagctgattaccggctggctgcgc
aacgataacggcagcgatgctgattacagctatgaggcgctgaaagcttatcagatgctg
tatcagccgccgcattatgacggcaagttcctgcatgcctggctaatgctcaacctgcag
cgcactctgccgcagaacgtcactcaggcgcagctgaagcagctggaatggcatcttagc
cagctgctggaaaaccagatccaggcttctccctatgcgcgggatgacgcgctggtaaag
cgcgagcaggcgctgattaaccagatgccgctgtcacagcgcgtctgggggcggctcaag
cgcctgctggagcacgatgaaagcctgaaagcggtgtcgctggcctctcttggcggcccg
caaagcgagctggtgttctcgcgcaagagcggtcgctcgattgccgatggcattcccggc
ctgtttaccccggccggctactggcagagctttgataagcatattgcggcggtgacggcg
gcgctgcatgatgacgaccgctgggtgctgggcgcacagtcagccggggagagccagcag
caaaccgatgcggcggtgcgccagctgtatatcggcgactatatccgccagtgggatggc
ctgttacaggacattcagctgaacaacagcgccgatcttgcccagcgcatcaatagcgcc
cggctgctttccggtaacaactcgccgctgcgcaaactggtgatgaacctcagccattat
ctggtgctggaaaaattgccaacggatgagaaacaggcgggcaaagagaaggacgcagaa
gccgataacagcgccacccgcaccctgcaggcgctgttccgctcgcgccagaatagtacg
gcggcgacggcagagcagacgcctgaacaggcggtggccaaccactttgcgccggttatc
gaactggcaaagccgctggaacagggcggtaaaaccatcgcctttgatgactttatccgc
cagattgatgacctgtatcgctatctgacggcggtgcaggatgccgccaacagcggcatg
ccgccgcccgccggagatgccatcagccatctgcaggccagcgccggacggttacccggt
tcgttgcaaaccctgttctccatgctcgcggtcggtgccagcagtgacgcgcagcgccgc
gaactggaaaacgtacgcaagcgcatcagcagcgaagtcggtggcttctgccgccaggcg
attgccgggcgctacccgctggtacgttcggcgcgcagcgaagtgacgccggatgacctg
gcgcgcatgtttgcccccggcagcggcctgatggacagcttcttccgcgataaccttgcc
aataaagtggataccacgcagtcggcctggcgttttacgccgggcattgacggtaagagc
atcggcggcgaagacattttgcgcccgttccagcaggcgcaaagcatccgtgatgccttc
tttgctaacggtgccaccacgccagcgtttcgcgtgacggtgcgcacgctgcgcatggat
aacgagatccttaacctgacgctggatgttgacggccagctgctgcgttacagccacggg
ccgcaggcggtacagttgatgaactggccgggcagtggcggcactaaccaggtgcgtatg
cagctggggctggtggatggcaccacctctacgctggtgactaacggcgtctgggcgctg
aaccgcttctttgaccgtgcacagttagcgccgggcagcagcagcctgagccgtcaggcc
agctttaacgttgacggccatcgcgtgacgctggagttcactccgaacagcatccgcaat
ccgtttcagctttccgggttcgcatgcccgtag

DBGET integrated database retrieval system