KEGG   Erwinia sp. Ejp617: EJP617_04840
Entry
EJP617_04840      CDS       T01935                                 

Definition
(GenBank) Type VI secretion system, lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
erj  Erwinia sp. Ejp617
Pathway
erj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:erj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EJP617_04840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:erj02044]
    EJP617_04840
Secretion system [BR:erj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EJP617_04840
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ADP10165
UniProt: E3DEW2
Position
complement(534855..535367)
AA seq 170 aa
MHRLSISRLITQAFLLAAFTLLAGCVSSSRSVPAQYSLVFQAHPQINDSAPLKVRVLLLK
SDADFMAADFYSLQTNPQGVLGQNLLNSEQFFLMPGQTDKKRAGQSSPEARYIGIMAEYQ
TLDGKKWRVSLPVPLPAERHFYQIWQGDADNLRADVIADINGVRVINARD
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcacagactctcgatttctcgcctgataactcaggcgtttttactggcagcgtttacc
ctgctggccggttgtgtttcgtcttcacgcagtgtccccgcgcaatacagcctggttttt
caggctcaccctcagatcaatgattcggctccgctaaaggtgcgggtgctgttgctgaag
tcggatgcggattttatggcggctgacttttactcgctgcaaaccaatccgcaaggagtg
ctggggcaaaacctgttgaacagtgagcagtttttcctgatgccggggcagactgacaaa
aaacgggccgggcagagcagcccggaggcgcgttatatcggcattatggcggaatatcaa
acgcttgatggcaaaaagtggcgagtttctttgccggtgccccttcctgccgaacgccat
ttttatcaaatttggcaaggggatgcggataatctgcgcgccgacgttatcgccgatatc
aacggtgtccgtgttattaacgcccgcgattaa

DBGET integrated database retrieval system