KEGG   Erwinia sp. Ejp617: EJP617_11080Help
Entry
EJP617_11080      CDS       T01935                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00051  Fructose and mannose metabolism
erj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EJP617_11080 (mtlD)
Enzymes [BR:erj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     EJP617_11080 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADP10789
UniProt: E3DKK5
Position
1212562..1213710
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGVQLTFADVNQIVLDALNARGEYPVHVVGEQSQIERV
KGVNAVHTASDEVIALVAEVDIVTTAVGPQILERIAGGIAKGIAKRSDSANSRPLNIIAC
ENMVRGTTQLKAHVLRALPGQYHAWLEEHVAFVDSAVDRIVPPSAADSSDPLEVTVETFS
EWIVDKTQFKGELPTIPGMELTDNLMAFVERKLFTLNTGHAIAAYLGQLAGHKTIREAIL
DKNVRAVVQGAMEESGAVLIKRYGFAADKHAAYIQKILNRFENPYLNDDVERVGRQPLRK
LSAGDRLIKPTLGTLEYHLPNDNLVTGIAAALHYRNDQDPQALELAALLSSQDVATTLAQ
ISGLDSDSDVVKAVVKAWNTLA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggtgccggtaacatcggccgtggctttattggtaaactgctg
gcggatgccggagttcagctgactttcgccgacgtcaatcagattgtactggatgccctc
aacgcccgtggcgaatatccggttcacgtcgtcggtgagcaatcgcagattgaaagggta
aaaggcgtcaatgccgtgcacaccgccagcgatgaggttattgcgctggtggctgaggtt
gatatcgttaccacggcggttggcccgcaaatccttgaacgtatagccggcggcattgca
aaaggtattgccaaacgcagtgatagcgctaattcccgaccgctaaatattatcgcctgt
gaaaacatggtgcgcggcaccacgcagcttaaagcgcatgtgctgcgcgcgttgcccggg
cagtatcacgcctggctggaagaacacgtcgcctttgtcgactctgcggtagatcgtata
gttcccccttctgcagcagacagcagcgatccgctggaagtaacggttgaaacctttagc
gagtggattgttgataaaacccaatttaaaggcgagctgccaactattcccggtatggaa
ctgaccgataatctgatggcgtttgtcgaacgcaaactgtttacgctcaataccgggcac
gctattgccgcctatctcggccagctggccggccataaaacaattcgcgaagcgatactg
gataagaacgtgcgggcggtagtacaaggagccatggaagagagcggcgcggtactgatt
aagcgctacggttttgcggcggataaacatgctgcctatatccagaaaatccttaaccgc
ttcgaaaacccgtatctgaacgatgatgtggagcgcgtgggccgccagccgctccgcaag
ctgagtgcgggcgaccgcctgattaaacctacgctgggcaccctggagtaccatctgccg
aatgataatctggtcaccggcattgccgcagcactgcattaccgcaacgaccaggatccg
caggcgctcgaactagccgcactgctgtccagccaggatgtcgccaccacgctggctcaa
atctccggactggatagcgacagcgatgtggttaaagcggtagtgaaagcctggaacacc
ctggcataa

DBGET integrated database retrieval system