KEGG   Erwinia sp. Ejp617: EJP617_12560Help
Entry
EJP617_12560      CDS       T01935                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00540  Lipopolysaccharide biosynthesis
erj01100  Metabolic pathways
Module
erj_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:erj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EJP617_12560 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:erj01005]
    EJP617_12560 (rfaD)
Enzymes [BR:erj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     EJP617_12560 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:erj01005]
 Unusual sugar
  EJP617_12560 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 Ldh_1_N KR
Motif
Other DBs
NCBI-ProteinID: ADP10937
UniProt: E3DBS4
Position
complement(1385558..1386490)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIIKALNDKGITDILVVDNLKDGTKFANLADLNIADYMDKEDFLIAI
LADEDFGDVEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHWCLEHQVPFLYASSAATY
GGRNADFIEERQYEQPLNVYGYSKMLFDHYVRDILPEAQSQVCGFRYFNVYGPREGHKGS
MASVAFHLNTQLNQGENPKLFAGSDGFKRDFIYVEDVAAVNLWFWENAVSGIFNCGTGRA
ESFQEVADAALKYHQSGEIEYIPFPEKLKGRYQEFTLADLTKLRAAGYDKPFKTVAEGVA
DYMAWLNRKA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgttaccggcggtgctggattcattggtagtaacatcattaaagcgcttaat
gacaagggtatcaccgatattctggtggtcgacaacctgaaagacggcactaaattcgct
aaccttgccgacctgaatatcgccgactacatggataaagaagacttcctgattgcgatt
ctggcagatgaagacttcggcgatgtagaagcaattttccatgaaggcgcgtgttcttcc
acgaccgagtgggatggcaaatacatgatggataacaactatcagtattcaaaagagcta
ctgcactggtgcctggaacatcaggttccgttcctgtatgcctcatctgccgccacttac
ggtggtcgtaacgccgactttatcgaagaacgccagtacgaacagccgctgaatgtttac
ggctactctaaaatgctgtttgaccactacgtgcgtgacattctgccggaagcgcagtcg
caggtatgtggtttccgttatttcaacgtctacgggccgcgtgaagggcacaaaggcagc
atggcgagcgtggcgttccatctcaacacgcagctgaatcagggcgaaaacccgaaattg
ttcgcaggcagcgacggcttcaaacgcgactttatttacgttgaggatgtcgccgcagtg
aatttgtggttctgggaaaatgccgtctccggtatctttaactgcggtacaggtcgtgct
gaatccttccaggaagtcgccgatgccgcgttgaagtaccatcagagcggtgaaatcgaa
tacatccctttcccggaaaaactgaaaggtcgttatcaggaattcacgctggccgatctg
accaaactgcgtgcggccggctacgataagcccttcaaaaccgttgcggaaggtgtcgcg
gactatatggcgtggcttaaccgtaaagcgtaa

DBGET integrated database retrieval system