KEGG   Erwinia sp. Ejp617: EJP617_22930Help
Entry
EJP617_22930      CDS       T01935                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00020  Citrate cycle (TCA cycle)
erj00640  Propanoate metabolism
erj00660  C5-Branched dibasic acid metabolism
erj01100  Metabolic pathways
erj01110  Biosynthesis of secondary metabolites
erj01120  Microbial metabolism in diverse environments
erj01130  Biosynthesis of antibiotics
erj01200  Carbon metabolism
Module
erj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
erj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:erj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EJP617_22930 (sucC)
   00640 Propanoate metabolism
    EJP617_22930 (sucC)
   00660 C5-Branched dibasic acid metabolism
    EJP617_22930 (sucC)
Enzymes [BR:erj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EJP617_22930 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADP11974
UniProt: E3DKT6
Position
2505720..2506886
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAENWLGKRLVTYQTDAGGQPVNQILVEAATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPHLIHKMALDPLTGPQPYQGRELAFKLGLTGKQVGQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLVCLDGKLTADGNALFRQPDLREMRDPSQEDS
REAHAAQWELNYVALEGNIGCMVNGAGLAMGTMDIVKLSGGQPANFLDVGGGATKERVTE
AFKIILSDDAVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLSDAAQRVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgagtatcaggcaaaacagttgtttgcacggtatggcttgccggcacca
accggttatgcctgcacaacgccgcgtgaagcagaagaagccgcctccaagattggcgct
ggcccgtgggtagtgaaatgtcaggttcacgccggtggccgtggtaaagcgggcggcgtg
aaggttgtcaacagcaaagaagatatccgcgctttcgctgagaactggctgggtaaacgt
ctggtgacctatcagactgatgctggcggtcagccggtaaaccagattctggttgaagct
gcgaccgatatcgataaagaactttatctcggcgcagtggttgaccgtggtacccgccgc
gtggtgtttatggcttccaccgaaggtggagtagaaatcgaaaaggttgctgaagaaacc
ccgcacctgatccacaaaatggcgctcgacccgctgaccggcccacagccttatcagggc
cgtgagctggcgttcaagctggggctgaccggtaaacaggtgggtcagtttaccaagatc
tttatgggtctggcgacgctgttcctggagcgcgatctggcgctggttgagattaacccg
ctggtgatcaccaaacagggcgatttagtctgcctggacggcaaactgaccgccgacggc
aatgcgctgttccgccagcccgatctgcgcgaaatgcgtgacccaagccaggaagactcg
cgtgaagcacatgctgcccagtgggagctgaactatgttgccctggaaggtaacattggc
tgtatggtgaacggtgccggtctggcgatgggcacaatggacatcgtgaaactgagcggc
ggccagccggccaacttcctcgacgtgggtggcggcgcgaccaaagagcgcgttaccgaa
gcctttaaaatcatcctgtctgacgatgcggtgaaagcggttttcgttaacattttcggc
ggcatcgtgcgctgcgatctgatcgcagacggtattatcggtgcagtggcggaagtgggc
gtcaacgtgccggtggtggtgcgtctggaagggaacaatgccgagctgggtgccaaaaaa
ctggcggacagcggcctgaatattattgcagcaaccagcctgagtgacgcggcgcagcgc
gttgttgctgcagcggagggtaaataa

DBGET integrated database retrieval system