KEGG   Erythrobacter sp. KY5: CD351_08240
Entry
CD351_08240       CDS       T05511                                 

Definition
(GenBank) protocatechuate 3,4-dioxygenase
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
erk  Erythrobacter sp. KY5
Pathway
erk00621  Dioxin degradation
erk01100  Metabolic pathways
erk01120  Microbial metabolism in diverse environments
erk01220  Degradation of aromatic compounds
Module
erk_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:erk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CD351_08240
Enzymes [BR:erk01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     CD351_08240
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: AWW74413
UniProt: A0A2Z4K002
Position
1744938..1745753
AA seq 271 aa
MAEIVGGFASSHILMSSNGVEDQANRVVEGMVEIGKRIRSLKPDVILVATNDHMFNESLA
MQAPFSIGVADTYTPFGDLGVPQVPRPGHRAFAEELLGHTAGNGFDLAKIEKLNPDHGVS
VPMLFADPDNTIPLVPLYLNLIMKPTPTPRRCWDLAREVNRFVTESCTTVERVVVLGAGG
LSHWVGERHVGVNEGWDRTLLADFEEGRFEKYVNLTPAEIELASGNGGLEIIHWLFMAGA
VGAERSEVLYYEPMVEWMTGMGGIAAVKTAA
NT seq 816 nt   +upstreamnt  +downstreamnt
atggctgagatcgtagggggctttgccagctcgcatattctcatgtcgtccaatggcgtg
gaagaccaggctaaccgtgttgtcgagggcatggtcgaaatcggaaagcgcattcgctcg
cttaaacccgacgtcattctcgtcgcgaccaatgaccacatgttcaatgagtcgttggcc
atgcaggcgccgttctcgataggtgtggccgacacgtacacgccatttggcgacctcgga
gtgccgcaggtgccgcgcccggggcatcgggccttcgccgaagaattgctcggccacacg
gcaggtaacggatttgaccttgccaagatcgaaaaacttaatccagatcacggcgtcagc
gtgccgatgctgttcgccgatcccgacaacaccatcccactcgttccgctttatctcaat
ctcatcatgaagccgaccccgacaccgcgtcggtgctgggatttggcgcgcgaagtcaat
cgcttcgttaccgaaagctgcacgacagtggagcgggtcgtcgtcttgggagccggtggt
ttgtcgcactgggtcggagagcgccatgtcggcgtcaacgagggttgggaccgcacattg
ctggctgatttcgaagaaggtcgcttcgaaaaatacgtaaacctgactcctgcggagatc
gagctcgccagtgggaatggcggccttgagatcatccattggctgttcatggcaggcgcc
gttggcgcggagagatccgaggtcctctactacgaaccgatggtcgaatggatgaccggc
atgggagggatagctgccgtaaaaacagctgcttga

DBGET integrated database retrieval system