KEGG   Erythrobacter sp. KY5: CD351_10140Help
Entry
CD351_10140       CDS       T05511                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
erk  Erythrobacter sp. KY5
Pathway
erk00450  Selenocompound metabolism
erk00970  Aminoacyl-tRNA biosynthesis
erk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CD351_10140
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CD351_10140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:erk01007]
    CD351_10140
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:erk03016]
    CD351_10140
Enzymes [BR:erk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CD351_10140
Amino acid related enzymes [BR:erk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CD351_10140
Transfer RNA biogenesis [BR:erk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CD351_10140
 Prokaryotic type
   Other AARSs
    CD351_10140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AWW74782
UniProt: A0A2Z4K1A8
Position
2141363..2142940
Genome map
AA seq 525 aa AA seqDB search
MSDIEYAPYYITTAINYPNGRPHIGHAYEGIAADVIARFQRLKGREVRFQTGTDEHGLKM
ARKAEEQGRTPRELADEMSGYFRQMDEALNIDFDRFIRTVEPDHHRASQAIWQRMEKAGD
LYLDRYEGWYSVRDEAYYDESELVEGEGDQKLSPQGTPVEWTVEESWFFRLSKYEKPLLD
LLRSPGFLEPASRRNEMIAFVEQGLRDLSVSRTSFDWGVKVPGSDDHVMYVWVDALTNYL
TGLGFPDETPEMAKFWPASLHLIGKDIVRFHTVYWPAFLMSANLPVPQKVFGHGFLLNRG
QKESKSLGNVTDPLELAEQFGVDNLRYFLMREVAFGQDGSYSPEAIVTRANAELANSFGN
LAQRTLSMIAKNMDGALEPFDLAEDDIALLDTVKQACATDLPREFEQLAFSVGIEAWIKA
VYACNQYVDEQAPWTLKKTDPERMKAVLQTLFRAIRDLAIAIQSVVPEKAAAVLDQLGVP
DNERLFENLDDDSWFDRLAGSGHVVAKPTPIFPRLELPETAEESA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacattgaatacgcaccctactacatcaccaccgcgatcaattaccccaatggc
cgaccgcatatcggtcacgcatatgaggggatcgcggccgacgtcattgcccggtttcaa
cgcctcaaggggcgcgaagttcgcttccagaccggcactgacgagcacggcctcaagatg
gctcgaaaggccgaggagcaggggcgcactccgcgcgagctcgcagacgagatgtcaggc
tatttccggcagatggacgaagcgctgaatatcgacttcgaccgcttcatccgaaccgtt
gaacccgatcaccatcgcgccagtcaggcgatctggcagcggatggagaaagcaggcgac
ctctatctggatcgctatgaaggttggtattcggtccgcgacgaagcctattacgatgaa
agcgaactggtcgaaggtgaaggcgaccagaagctgtccccgcaaggcactccggtcgag
tggaccgtcgaagagagctggttcttccgtctttcgaagtacgaaaagcctcttcttgat
ttgctcaggtcacccggtttccttgagcctgctagccgtcgcaacgaaatgatcgctttc
gtcgaacagggccttcgcgatctttcggtcagccggaccagcttcgattggggcgtcaag
gtgcccggttcggacgatcacgtgatgtatgtctgggtcgatgcgctgaccaactacctg
actggccttggtttcccggatgaaacaccggagatggcgaaattctggccggccagcttg
catctgatcgggaaagacattgtccggttccacacggtctactggcccgctttcctgatg
agcgccaatctgcctgtgcctcaaaaagtgttcggtcacggcttccttctcaatcgcgga
cagaaggaatcgaagtcgcttggcaacgtcaccgatccgcttgaacttgctgaacaattt
ggcgtggacaacctccgctacttcctcatgcgcgaggtcgcgtttgggcaggacgggtct
tactcgcccgaagccatcgtaacgcgagccaatgcggagcttgcgaacagtttcggcaac
cttgcgcagcgcactttgtccatgatcgccaagaatatggacggggctctcgaaccgttt
gatcttgcggaagacgacattgctttgctcgacaccgtcaaacaggcgtgcgctacggat
ctccctcgagaattcgaacaattggcgttctcagtcggtatcgaggcatggatcaaggct
gtctatgcctgcaaccaatatgtcgatgagcaagccccctggacgctgaaaaagaccgat
ccggagcgcatgaaagctgtgctccagacgcttttccgcgccattcgtgatctggccatc
gctattcaatcggtagttcccgagaaagctgctgcagtcctcgaccaactcggcgttcca
gacaacgaacggctattcgaaaatcttgatgacgatagctggttcgaccggttggctggc
agcgggcacgtggtggccaaacccactccgatcttcccgcgcctcgaattgcccgaaacg
gcagaggaaagcgcgtga

DBGET integrated database retrieval system