KEGG   Erythrobacter sp. KY5: CD351_13170Help
Entry
CD351_13170       CDS       T05511                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
erk  Erythrobacter sp. KY5
Pathway
erk00350  Tyrosine metabolism
erk00643  Styrene degradation
erk01100  Metabolic pathways
erk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:erk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CD351_13170 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    CD351_13170 (maiA)
Enzymes [BR:erk01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     CD351_13170 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AWW75381
UniProt: A0A2Z4K3Z2
Position
2767605..2768249
Genome map
AA seq 214 aa AA seqDB search
MKLYGYYRSSTSYRLRIALELKGFDYENVPVNLLKAEQKDASFTSRNPFGSVPLLEAGGR
DRAQSMAMLEWLDEAYPDPALLPADTEARYTVRELTYAIATELHAPLNLPVLKWLKDEYG
KSQEEIGEWYRHWLERTLSPVEARLSQLGTTRFLGDAPGMFEVVLLPQVYNARRFDFDFT
DYHHITAIEAACLALPAFQRAHPDNQPDNPERNT
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctacggctactatcgaagctcgaccagctaccgcttgcggatcgcgcttgaa
ctcaagggtttcgattacgagaacgtgccggtgaacctgctcaaggctgagcagaaggac
gcaagcttcaccagtcgcaacccgttcggctcggtgccgcttctcgaagccggtggccgc
gaccgcgcccagtcgatggcgatgctcgaatggctggacgaggcctatcccgatcccgcg
ctgctgccagccgataccgaagcgcgctataccgtgcgcgaactgacctacgccattgcg
accgaactgcacgcgccgctcaacctgccggtgctgaaatggctcaaggacgaatacggc
aagtcccaggaggagatcggcgagtggtatcgccattggcttgagcgcacgctctcgccg
gtggaggcgcggctgtcgcagcttgggacgacgcgcttcctcggcgatgcgccgggcatg
ttcgaagtcgtgctgttgccgcaggtctacaatgcgcgccgcttcgacttcgacttcacc
gactatcaccacatcaccgcgatcgaggcggcgtgccttgccctgcccgccttccagcgc
gctcacccggacaaccaaccagacaaccctgagaggaacacatga

DBGET integrated database retrieval system