KEGG   Erysipelothrix larvae: AOC36_04410Help
Entry
AOC36_04410       CDS       T04263                                 

Definition
(GenBank) recombinase RecD
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
erl  Erysipelothrix larvae
Pathway
erl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:erl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOC36_04410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:erl03400]
    AOC36_04410
Enzymes [BR:erl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AOC36_04410
DNA repair and recombination proteins [BR:erl03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOC36_04410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 Helicase_RecD T2SSE DUF2075 RsgA_GTPase PIF1 AAA_29 MeaB HHH_2 NACHT NTPase_1 UvrD_C AAA_12 UvrD-helicase AAA_16 AAA_28 PhoH AAA_25 ABC_tran AAA AAA_22
Motif
Other DBs
NCBI-ProteinID: AMC93240
UniProt: A0A120JTL3
Position
965254..967386
Genome map
AA seq 710 aa AA seqDB search
MNVEIEGIVDSEIFFNEGNHYGVYRVVASDSNDRPITIVGNFYKLEVDSYYAFSGSFIEN
PRFGMQFQVESYEKKLPIKDEYIIRYLSGVSFPGIGPKTAQILVEKMGSDVLEIIKNSRD
EMLEVTGVSSDKIEVIKSVLQHQTGFDESIQFLNMHGITGTLIQSILNIYGEDTRQVLEI
NPYRMIEEVSGIGFKTADKLGQSLLFEQDHPFRLEGYLIYVYQEVCFKDGHSFIYKEDLH
NRIDISGDDFEAAYDRLLQKGILIDDEGKIYHHTQYDAEVNVARFLVDHKHKSVFELDNI
DESIVRIQRRLGIVFDDNQRDAIKQVFDQSVVIITGGPGTGKSTLLSGVISIIQDELKDV
SITLCAPTGRAAKRLESLTKVNAATIHSVLKWNLHTNVFGMNETNPLESDVVIVDEFSMV
DIWLLYKLILAGSKVKKFVFVGDKDQLPSVGPGYVLSDLLESDGFEVIRLEHNYRQEQGS
EVIDLALSFNEGIFDISHYHKDVKYFDSRYGSAKDIVVKVVNEAMDRGYSLNDIQVLSPK
YAGPNGIDNLNYFLQKSCNPESMHKRFVQVGARIFREGDKILQLKNQPDDGVYNGDIGTL
VEIDDDRSLIVDFDGLFVTYDKSNYINISHAYAMSVHKAQGSEYPIVILLASRDFGMMLS
RKLYYTAITRSSKSVILVGDLNSFDKASKTDTQIHRNTYLKERILHLMND
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttgaaattgaaggaattgttgacagcgagatattctttaatgaaggcaatcat
tacggtgtgtatcgcgttgtcgcatctgactcaaatgatcgtccaataactattgtcgga
aacttctataagttagaagttgattcatattatgcatttagcgggtcctttatcgagaac
ccgcgttttggtatgcagtttcaggttgaatcctatgaaaagaaacttcccatcaaagat
gaatacattattcggtatttaagtggggtctcatttccgggaattggacccaaaactgct
caaattttggttgagaaaatgggatcagatgttttagaaatcataaaaaacagccgtgat
gagatgttagaagttacaggggtgtcttcagacaaaattgaagtgattaaatctgtactc
caacaccaaacaggctttgatgaatccatccagtttttaaacatgcatggaattacaggt
accttgattcaatcaatcttgaatatctatggagaagatactcgtcaagtacttgaaatc
aatccgtaccgcatgattgaagaagtcagtggtatagggtttaaaaccgcagataaatta
ggtcaatctttattgtttgaacaagatcatccgttcagacttgaagggtacctcatttac
gtatatcaagaagtgtgtttcaaagatggacattcctttatctacaaagaagatttacac
aaccgtatcgatattagtggcgatgattttgaagctgcatatgatcgtcttttacaaaaa
gggatattaattgatgatgaagggaaaatctatcaccacacacaatatgatgctgaagta
aatgtcgcaaggttcttagttgatcataaacacaaatcagtgtttgaactggataatatt
gatgaatccattgttcggattcaacgacgtttggggatagtttttgatgataatcaacgc
gatgccattaaacaagtctttgatcaatcggttgttattattactggaggcccagggacg
ggtaagagcactttattgtccggtgtcatatcaattatccaagatgaacttaaagacgtc
agtattacgctatgtgcgcctactggacgcgcagcgaaacgtttagaatctttaaccaaa
gtaaatgccgcaacgattcactcagttttgaaatggaaccttcataccaatgtatttgga
atgaatgaaaccaatccacttgaaagtgatgtcgtgattgttgatgagttttcaatggta
gacatttggcttttatataagttaatcttggcgggttctaaagtaaagaaatttgtattt
gtgggggataaggatcagctcccatccgttgggcctggatatgttctttctgacttatta
gagagtgatgggtttgaagtcatccgacttgaacacaattaccgtcaagaacaagggtca
gaagtcattgatttagccctttcgtttaatgaaggaatttttgatatcagtcattatcat
aaagatgtgaagtattttgattcaagatatggaagtgcaaaggatatcgttgtaaaagtt
gtaaatgaagcgatggatcgtggatattctctgaatgatattcaagtattatctccgaaa
tatgctggacccaatggaattgataatctgaattactttcttcaaaaatcttgcaatcct
gaatcgatgcataaacgctttgtgcaagttggcgcgcgcatctttagggaaggtgataag
attcttcaactgaaaaatcaaccggatgacggtgtttacaatggcgatattggaacattg
gtggagattgacgatgatcgcagtttgattgtggattttgacggattatttgtaacttac
gacaaatcaaattacattaatatatcccatgcctatgcgatgagtgttcataaagcacaa
ggaagtgaatatccaattgtaatcttgctggcatcaagagattttggaatgatgttatca
cgcaaactttattacactgcgataacccgttcatcgaaatcggtgattttggtaggggat
ttgaactcgtttgataaagcaagcaaaaccgatacgcaaattcacagaaacacctatctt
aaagaacgcattcttcatctcatgaacgattaa

DBGET integrated database retrieval system