KEGG   Erysipelothrix larvae: AOC36_07260Help
Entry
AOC36_07260       CDS       T04263                                 

Definition
(GenBank) hypothetical protein
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
erl  Erysipelothrix larvae
Brite
KEGG Orthology (KO) [BR:erl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOC36_07260
Enzymes [BR:erl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     AOC36_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Dus
Motif
Other DBs
NCBI-ProteinID: AMC93787
UniProt: A0A0X8H0G6
Position
complement(1568048..1569064)
Genome map
AA seq 338 aa AA seqDB search
MKLLEPHTLKNLTLKNRVVMEPMCMYSCFNHDGCATSFHQAHYTSRAIGQVGLILVEATG
VCPEGRITDRCLGLYNDSQKEALKKVVDAVHQEGSMIGIQINHAGRKCTAVDGVDTIYGP
SACAYDASSRIPHELTLAEIQHVFHQFKEAARRADEAGFDVLEIHGAHGYLISQFMSPCS
NKRTDAYRDGNLFIHGVIKAVKESWPETKPLIIRVSATDYEPHGYQVEDTIRMLKPSLDM
LDAINVSSGGITPIPPTKIYPGYQIGFAHQIKHALNIPVIGCGLLGSSELASCLIESETV
DFIGLARPLLRNPHWVIETAINRNIRESVPPQYERGFK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattagaaccacatactttaaaaaatctaacactaaaaaatcgtgttgtaatg
gaaccgatgtgcatgtattcatgcttcaaccatgatggatgtgcaacatcctttcatcag
gcacattatacatcacgggcaattggacaagttggactcattcttgttgaagcaacgggt
gtttgccctgaaggaagaatcacagatcgctgcttaggcctgtacaatgattcgcaaaaa
gaagcccttaaaaaggtagtggatgcagtccatcaagaaggctcaatgattgggattcag
attaatcacgcaggtcgaaaatgcacggctgtagatggtgtcgatacgatttatggtccc
agtgcgtgtgcgtatgatgcatcaagtcgcatacctcatgaactcacactcgctgaaata
caacatgtttttcatcagttcaaagaggctgcacgacgtgctgatgaagcaggatttgat
gtattggaaatacatggagctcacggctatctcatctctcaatttatgagcccttgctca
aataagcgaacggatgcataccgtgatgggaacctttttatccacggtgtcataaaggct
gtcaaagaaagctggccagaaacaaaaccgttaatcatacgtgtgagcgccacagattac
gaaccacacggttatcaggttgaagatacaatacggatgctgaagccaagtcttgatatg
cttgatgccatcaatgtctcttcaggagggataacaccgattccacccactaaaatctat
cctggatatcaaattggatttgcgcatcaaattaaacacgcactcaatattccagtgatt
ggatgtggattacttggaagttcagaacttgcatcgtgtttgattgaatccgaaaccgta
gattttattggactagcacggccactactcagaaacccacattgggtgattgaaactgca
atcaaccgcaacatcagggaaagtgtcccaccacaatatgaacgcggatttaaataa

DBGET integrated database retrieval system