KEGG   Enterobacter roggenkampii: BFV67_03875Help
Entry
BFV67_03875       CDS       T05556                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ern  Enterobacter roggenkampii
Pathway
ern00900  Terpenoid backbone biosynthesis
ern01100  Metabolic pathways
ern01110  Biosynthesis of secondary metabolites
ern01130  Biosynthesis of antibiotics
Module
ern_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ern00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BFV67_03875
Enzymes [BR:ern01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BFV67_03875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AOP94358
Position
848958..850157
Genome map
AA seq 399 aa AA seqDB search
MKHLTLLGSTGSIGCSTLDVVRHNPELYTVTALVAGKNVQRMVEQCLEFTPRYAVMDDEE
SARLLKAQLLEKGSRTEVLSGQQAACEMAALDEVDQVMAAIVGAAGLLPTLAAIDAGKDV
LLANKESLVTCGRLFMEAVKQRGARLLPVDSEHNAIFQSLPQPFQQNLGYADLEQNGVVS
ILLTGSGGPFRETPLSELRAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAKQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHSMAWPNRVKSGVKPLDFC
KLSSLTFSEPDYDRYPCLKLAMTAFDQGQAATTALNAANEITVEAFLNQQIRFTDIAALN
LSVLEMMDLREPQSVEEVLAVDAAARNIARQQVTRLASW
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatttaacactccttggctcaaccggctccatcggttgcagcactctcgacgtt
gttcgccataatcctgaactttacaccgtgacagcgctggtggccggtaagaatgtgcag
cgaatggttgagcagtgcctggagtttacgccccgctatgcggtgatggatgacgaagag
agcgcgcgcctgctgaaagcacagctgcttgagaagggcagtcgaaccgaggtgctgagt
ggccaacaggcggcctgcgagatggcggcgctggatgaggtggatcaggtgatggcggcc
attgtcggggcggcaggattattgccgacgcttgccgcgattgatgccggtaaggacgtt
ctgctggccaataaagagtcgctggtcacctgcggacgcctgttcatggaggcggtgaag
cagcgcggcgcgcgtcttttgcccgtcgacagcgagcacaacgcgatttttcagagttta
ccgcaaccttttcaacagaacctggggtacgctgacctggagcagaatggcgtcgtgtcg
attctgcttaccgggtctggtggcccgttccgtgaaacgccactgtctgaactgcgtgcg
atgacgccggatcaggcgtgccgtcatccgaactggtcgatggggcgtaaaatctccgtt
gactctgccaccatgatgaacaaaggtctggaatacattgaagcgcgctggctgtttaat
gcgtcagcgaaacagatggaagtactgattcacccgcaatcggtgattcattcgatggtg
cgttatcaggatggcagcgtgctggcgcagctgggtgaaccggatatgcgtacgccgatt
gcccattccatggcgtggccgaatcgagtgaagtccggcgtgaagccgcttgatttctgc
aagctaagttccctgacgttcagtgaaccagactacgaccgctacccttgtctgaagctt
gcaatgacggcctttgaccaggggcaggcggcgacaacggcactgaatgcagccaatgaa
attaccgttgaagcatttctgaatcagcaaattcgttttaccgatattgcggcgttaaat
ttatcggtactggagatgatggatttgcgcgaaccacagagcgtggaagaggtgctggcg
gtggatgcagctgcgcgtaatattgcgcgccaacaggtgacacgtctcgcaagctggtga

DBGET integrated database retrieval system