KEGG   Enterobacter roggenkampii: BFV67_15120Help
Entry
BFV67_15120       CDS       T05556                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ern  Enterobacter roggenkampii
Pathway
ern00020  Citrate cycle (TCA cycle)
ern00620  Pyruvate metabolism
ern01100  Metabolic pathways
ern01110  Biosynthesis of secondary metabolites
ern01120  Microbial metabolism in diverse environments
ern01130  Biosynthesis of antibiotics
ern01200  Carbon metabolism
Module
ern_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ern_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ern00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BFV67_15120
   00620 Pyruvate metabolism
    BFV67_15120
Enzymes [BR:ern01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BFV67_15120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AOP96468
Position
complement(3207810..3209459)
Genome map
AA seq 549 aa AA seqDB search
MKKMTAMLFSLAVGLNTVSMAAKADAPKEQETDVLLIGGGIMSATLGTYLQELQPDWSMT
MVERLDGVAQESSNGWNNAGTGHSALMELNYTPQKKDGSISIEKAVEINEAFQVSRQFWS
HQVNSGVLHDPHSFINTVPHMSFVWGEQNVNFLRARYAALQQSTLFRGMKYSEDHAQIKE
WAPLVMEGRDPNQKVAATRTEIGTDVNYGEITRQLVTSLKKKENFNLQLSTEVRGFKRNA
DNSWSVTVADLKNNEAEHVIKAKFVFIGAGGAALKLLQESGIPEADDYAGFPVGGQFLVS
DNPEVVNRHLAKVYGQASVGAPPMSVPHIDTRMLDGKRVVLFGPFATFSTKFLKNGSLWD
LLSATTTSNVKPMMDVGLDNFDLVKYLISQVMLSDDDRFEALKEYYPQAKKEDWRLWQAG
QRVQIIKRDPKEGGVLRLGTEVVSDKDGTIAALLGASPGASTAAPIMLHLMEKVFKDKVA
SPEWQAKLKTIIPSYGTKLNGNVSATEQELEYTSRVLQLQYIKPQAADAAPKAELKPQPE
NKPVADIAL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgactgccatgctcttttctctggccgtggggcttaacaccgtctctatg
gcggcgaaagctgacgcaccaaaagagcaggaaacggacgtccttttaatcggtggcggt
atcatgagcgccacgctgggaacctatctgcaagaactgcagccggactggtcaatgacc
atggtcgagcgccttgatggcgtggcgcaggagagttcgaacggctggaacaacgccggt
accggccattcggcactcatggaactgaactatacgccgcagaaaaaggacggttccatt
agtatcgagaaggcggtagagatcaacgaggcgttccaggtatctcgccagttctggtct
caccaggtcaacagcggcgtactgcacgacccgcactctttcatcaacaccgtaccgcac
atgagctttgtgtggggcgagcagaacgtcaacttcctgcgcgcgcgctacgccgcgctg
cagcagagcacgctgttccgcgggatgaaatactctgaagaccacgcgcagattaaagag
tgggctccgctggtcatggaaggtcgtgacccgaaccagaaagtggcggcgacccgtacc
gaaattggtaccgacgtcaactacggtgaaattacccgtcagctggtgacgtctctgaag
aaaaaagagaacttcaacctgcagctcagcaccgaagtgcgcggtttcaagcgcaacgcg
gataacagctggagcgtgaccgttgccgatctgaaaaacaacgaagccgagcacgtcatc
aaggcgaagtttgtctttatcggtgcgggcggtgccgcgctgaaactgctgcaggagtcc
ggtattccggaagcggatgactacgcgggcttcccggtgggcggtcagttcctggtgtcc
gataacccggaagtggtgaatcgtcatctggcaaaagtgtacggtcaggcttccgtgggc
gcaccgccaatgtctgttccgcacatcgatacccgtatgcttgacggcaaacgcgtggtg
ctgtttggcccgttcgcgaccttctccactaaattcctgaaaaacggctccctgtgggat
ctgctcagcgcaaccaccacctctaacgtcaagccgatgatggacgtggggctggataac
ttcgatctggtgaaatacctgattagccaggtaatgctgtctgacgacgaccgtttcgaa
gcgctgaaagagtactatccgcaggcgaagaaagaagactggcgtctgtggcaggcgggt
cagcgcgtgcagatcatcaagcgcgatccgaaagagggcggcgtgctgcgtctgggcacc
gaagtggtgagcgataaggacggcaccatcgccgcgctgctgggtgcgtcaccgggtgcg
tctaccgctgcgccaatcatgctgcacctgatggaaaaagtgtttaaagataaagtcgcc
agtccggaatggcaggcgaagctgaagaccattattccatcctacggcacgaagctgaac
ggtaacgtgagcgcgacggagcaggagctggaatacaccagccgcgtactgcagctccag
tacatcaaaccgcaggctgcggatgctgcgccaaaagcggagctgaagcctcagccggaa
aacaaaccagttgcggatatcgcgctgtaa

DBGET integrated database retrieval system