KEGG   Enterobacter roggenkampii: BFV67_17475Help
Entry
BFV67_17475       CDS       T05556                                 

Definition
(GenBank) 5'/3'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
ern  Enterobacter roggenkampii
Pathway
ern00230  Purine metabolism
ern00240  Pyrimidine metabolism
ern00760  Nicotinate and nicotinamide metabolism
ern01100  Metabolic pathways
ern01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ern00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BFV67_17475
   00240 Pyrimidine metabolism
    BFV67_17475
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BFV67_17475
Enzymes [BR:ern01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BFV67_17475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AOP96903
UniProt: A0A1S2ADH7
Position
complement(3727700..3728461)
Genome map
AA seq 253 aa AA seqDB search
MRILLSNDDGIHAPGIQTLAKHLREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGD
IAVQMGTPTDCVFLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLNGYTHYDTAAAVTCSILRALGREPLRTGRILNINVPDLPLDEIKGIRVTRCGSRH
PADQVIPQQDPRGNTLYWIGPPGDKCDAGPDTDFAAVEEGYVSVTPLHVDLTAYSAHDVV
SGWLDRAGVNAQW
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatattgctgagtaacgatgacgggatccacgcgccaggcattcagaccctggcg
aaacacctccgtgagtttgcggatgtgcaggttgtggcgcccgatcgtaaccgcagtgga
gcgtctaactcgctgacgctggagtcgtcgcttcgcacctttacctttgaaaatggcgat
attgccgtacagatgggcacgccaaccgactgtgtttttctgggcgtgaacgcgctgatg
cggccgcgtccggatatcgtcgtctccggcattaacgccgggcctaacctcggcgatgac
gtgatttactccggcaccgtggcggccgcaatggaaggccgccatctgggattcccggcg
ctggcggtctcgttgaacggctacacgcactacgacaccgccgccgcggtgacctgttcg
atcctgcgggcgctcggccgcgagccgttgcgtaccggacgcatcctcaacatcaacgtg
ccggatcttcctctcgatgaaattaaaggcatccgcgtcacccgttgcgggagtcgacat
cctgccgatcaggtgatcccgcagcaggatccgcgcggcaacacgctttactggatcggc
cctcccggcgataagtgcgatgcgggtccggataccgactttgccgccgtggaggaaggc
tatgtttcggttaccccgctgcacgtagatttaaccgcgtatagcgcgcatgatgtggtg
tcgggctggctggatcgcgcaggagtgaacgcgcaatggtaa

DBGET integrated database retrieval system