KEGG   Enterobacter roggenkampii: BFV67_20155Help
Entry
BFV67_20155       CDS       T05556                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ern  Enterobacter roggenkampii
Pathway
ern03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ern00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BFV67_20155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ern03011]
    BFV67_20155
Ribosome [BR:ern03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BFV67_20155
  Bacteria
    BFV67_20155
  Archaea
    BFV67_20155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOP97391
UniProt: A0A167QEP0
Position
complement(4293550..4293882)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgcacagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggccctggacatcctgacctataccaac
aagaaagctgcggtattggtcaagaaagtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacatcgacgatctgaaagtcgcgaaaattttcgtagatgaaggccca
agcatgaagcgcattatgccgcgtgcgaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system