KEGG   Encephalitozoon romaleae: EROM_010420Help
Entry
EROM_010420       CDS       T03458                                 

Definition
(RefSeq) Ser/Thr protein kinase
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
ero  Encephalitozoon romaleae
Brite
KEGG Orthology (KO) [BR:ero00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ero01001]
    EROM_010420
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ero03036]
    EROM_010420
Enzymes [BR:ero01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     EROM_010420
Protein kinases [BR:ero01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   EROM_010420
Chromosome and associated proteins [BR:ero03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     EROM_010420
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    EROM_010420
  Sister chromatid separation proteins
   Polo kinases
    EROM_010420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Haspin_kinase Pkinase_fungal APH RIO1
Motif
Other DBs
NCBI-GeneID: 20520669
NCBI-ProteinID: XP_009263884
UniProt: I7AQ00
Position
I
AA seq 472 aa AA seqDB search
MSTKVELYMEIGTVITDHEYHTRYILKKLLGRGAYAQCYLAEIENGEQYAMKVVRLKDIK
SRKVHEKLESEISIHSKLDNPNIVKMYRSFRNEEYVFMVLELCERGALDALLKRNGKLKE
RHVARFVKQTVEGLMYLHDSVNVVHRDLKLGNLFLDSKFNVKIGDFGLSAVIKDGEKKIT
MCGTPNYIAPEVLFGKASGHSFEADIWSLGVIIYTLLVGVPPFQKKNVEDIYKMIKLNNY
IFPENCDLSSEAIDLITQILNTNPLERPTLEHILGHKFLSRKEHFLMRIYRNLMINKTQE
GVIDTDYVLFSIPVTKLRGIGYVLKSGVYGIYFSDHRNLMLKPNKKSVIYLSSAMESGKR
VFYKEEHLVEKIPGEILESYKGLQYFIRTFDNGFSFLDVEPCFIVKIRKIDCGFLFVMAD
STIVFDFVDGWRVVLSRCGERVSCYNGLGLASFNQEIRMKCIRILKNCLGCE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaaggtcgagctatacatggagattggaacggtcataacagatcatgaatac
catacaagatacattctgaagaagcttcttggaaggggagcgtatgcacaatgctatctg
gcagagatagaaaatggagagcagtatgccatgaaggtggtcaggctgaaggatattaaa
agtcggaaagttcatgagaagttagagtcggagatatcaatacactccaagctggacaat
cccaatattgtcaagatgtatagatcatttagaaacgaggaatatgtctttatggttctt
gagctctgtgagagaggggcgctggatgccctgctgaaaagaaatggaaagctgaaggaa
aggcatgtggcgagatttgttaaacagactgttgagggcctgatgtaccttcatgacagt
gttaatgttgtgcatagagacttaaagttagggaacctgtttctggactctaaattcaat
gtgaagataggagactttgggttgagtgcagtgataaaggacggggagaaaaagattact
atgtgtggaacaccgaactatatagcacccgaggttctgtttggaaaggcgagcggacat
tcttttgaagcagacatatggtctctgggggtgattatatacacattacttgttggtgtt
ccaccgtttcagaaaaagaacgtggaggacatctacaagatgataaagctcaacaactat
atattcccggaaaactgcgatctttcgagcgaggcgattgacctcataacacagatactg
aacacaaatcctcttgaaaggccaaccttggagcatattcttggccataagttcttgtca
aggaaggagcactttttgatgaggatctacaggaacctgatgatcaacaaaacacaggaa
ggggttatcgatacagattatgtccttttcagtatccctgtgacaaaactaagagggatc
gggtatgttctgaagtccggggtttatgggatatattttagcgatcataggaatctgatg
ttgaagccgaacaagaagagtgtgatatacctaagctcggctatggagagtggaaaaagg
gtgttttataaggaagagcatcttgttgagaagatacctggagagattctggaatcatac
aaaggattacagtatttcatcagaacatttgacaacgggtttagctttctggatgtagag
ccttgcttcattgtgaagataaggaagatagattgtgggtttttgtttgtgatggctgac
agtaccattgtgtttgattttgttgatgggtggagggtagtgctatccaggtgtggagaa
agggtctcgtgctacaacgggcttgggcttgcctcatttaatcaagagataagaatgaaa
tgcataaggattctgaagaactgcctcggatgtgaatga

DBGET integrated database retrieval system