KEGG   Encephalitozoon romaleae: EROM_110760Help
Entry
EROM_110760       CDS       T03458                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ero  Encephalitozoon romaleae
Pathway
ero00450  Selenocompound metabolism
ero00970  Aminoacyl-tRNA biosynthesis
ero01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ero00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EROM_110760
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EROM_110760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ero01007]
    EROM_110760
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ero03016]
    EROM_110760
Enzymes [BR:ero01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EROM_110760
Amino acid related enzymes [BR:ero01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EROM_110760
Transfer RNA biogenesis [BR:ero03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EROM_110760
 Prokaryotic type
   Other AARSs
    EROM_110760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 20564675
NCBI-ProteinID: XP_009265555
UniProt: I6ZL55
Position
XI
AA seq 546 aa AA seqDB search
MTKKFITSALPYVNNQPHLGNVIGSVLSGDVYSRYCKKKGETVVYICGTDEYGTAIEMEA
ISRGKTPQDVCEENRKLHKQVYDWFNIEFDYFGFTSLPAHTEVVQDLFMKMYNNGYFSEQ
EVEQLYCNTCVIFLADRYVVGKCKFCGDLRARGDQCDACGHTYNSLELVSPECSICGTTP
IVKSTTHLFFDLEAFKPRLEKLYKTNGHLWSQNAQNIFNQWISMEFFPRCMTRDLKFNWG
VPVPLKKFEGKVFYVWFDAPIGYLTFLKDLVGKDFEEWRKESELVQFMGKDNVSFHTIIF
PAMLYATGEEYPMIKRLSATEYLMFENQKFSKSRKHGIFGLDLVNGNLGKSCVWRYYLLK
IRPESTKDSNFTFHDFQQSVTADLINNLGNLVNRVLKYIGSKCNSKVSLLELNDNDKKCI
EEVNELYRKYLRKMEEIKLREGLQVVMDISRRGNEYIQEGIRNEDRKSHFFCLGFSIIGL
LGTLLHPFMPLTSSEILKMCNLEETRLPDQMNIIDGHTIGNNIYPVFKNFTDEQLEEMRK
YEASSV
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaattcataacaagtgccttaccttatgtaaacaatcagccacaccttgga
aatgttataggaagtgttctcagtggtgatgtgtacagcaggtattgcaagaagaaagga
gaaacggttgtgtatatatgtggaacagatgagtatgggacggccattgagatggaggct
atttcacgaggaaagacacctcaagatgtttgcgaagagaataggaagcttcacaagcag
gtttatgactggttcaacattgagtttgactactttggatttacatccctgcccgctcat
accgaagtggtacaagatctttttatgaagatgtataacaatgggtatttcagtgagcaa
gaggttgagcagctctactgtaacacctgtgtgatatttcttgcagacagatatgttgtt
ggaaagtgcaagttttgtggggacctaagagcaagaggtgatcaatgcgatgcctgtgga
cacacctacaactctcttgagcttgtgtcgcctgaatgctccatatgcggcaccacgccc
attgtgaagtcaactacacatttgttctttgacttggaggcattcaagccacgacttgag
aaattatataagacgaatggacacctgtggagtcagaatgctcaaaacatattcaaccag
tggatttcaatggagttctttccaaggtgtatgacaagagacttaaagttcaactggggg
gttcctgttcctttgaagaagttcgaagggaaggtcttctatgtctggtttgatgctccg
ataggatatctgacgtttttgaaagatcttgtcggcaaagactttgaggaatggcgtaag
gaatctgagcttgtacaatttatggggaaggataatgtgtcattccacacaataatattc
ccagcaatgctctatgcaactggagaggaatacccaatgatcaaaaggctatctgcaact
gagtacctcatgtttgagaaccagaagttctcgaaaagtaggaagcatgggatatttggg
ctggaccttgttaacgggaatcttgggaagtcatgtgtgtggaggtactatctgctgaag
atacgtcctgaatcaaccaaagattcgaacttcactttccatgactttcaacaatctgtc
acagcggatttgattaataaccttggaaaccttgtaaaccgagtgctgaaatacataggg
tccaaatgcaattcaaaagtatcattgctcgagcttaatgataatgataagaagtgcatt
gaggaggtaaatgagctatatcgcaaatacttaaggaagatggaagagataaagcttagg
gaggggctccaagtagtaatggatatttccagacgtggaaacgagtatatccaggaaggt
attcggaatgaggataggaaaagtcatttcttctgccttggattcagcattattggactt
ttaggtaccctcttgcatcctttcatgcctcttacttcatctgaaatactaaaaatgtgt
aatctcgaagagacaaggcttccagaccagatgaatataattgatggacacaccatagga
aataatatttatcctgtgttcaagaacttcacggatgaacagctcgaggagatgaggaaa
tatgaagcctctagtgtataa

DBGET integrated database retrieval system