KEGG   Erythrobacter sp. YH-07: DVR09_03340Help
Entry
DVR09_03340       CDS       T05587                                 

Definition
(GenBank) SDR family NAD(P)-dependent oxidoreductase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
err  Erythrobacter sp. YH-07
Brite
KEGG Orthology (KO) [BR:err00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DVR09_03340
Enzymes [BR:err01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     DVR09_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR ADH_zinc_N NAD_binding_10 Epimerase Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AXK41487
UniProt: A0A345YC35
Position
668877..669650
Genome map
AA seq 257 aa AA seqDB search
MKPVLSPAERTAFVTGATAGIGEATVRTLVASGWRCVVTGRRKERLDALVEELGADKVHA
ACFDVRDTDAMDAALAALPEAFAGIDLLVNNAGLAQGLSPAHEASLDDWQTMIDTNVTAM
VVLTRKLLPTLIERKGAIIAIGSVAGSYIYPGGNVYAGSKAFVNHFTLALRADLHGTGVR
VTSIEPGMVETEFTLVRTGSQEASDDLYRGADPMTGQDIADTIRWIAELPPHLNINRLEL
MPVNQDFAGFRVAREHH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtcctgagcccagccgaaaggactgcctttgtcaccggagccaccgcaggc
atcggcgaagccaccgtgcgcacgctggtggcgagcggctggcgctgcgtggtgaccggg
cggcgcaaggaacggctcgacgcactggtggaggagcttggcgcggacaaggtccatgcg
gcctgcttcgacgtgcgtgataccgacgcgatggatgccgccctcgccgctctgcccgaa
gcgttcgcgggcatcgatctgctggtgaacaatgccggcctcgcgcagggtctctcgccc
gcgcacgaagccagcctcgacgactggcagaccatgatcgacaccaatgtgacggccatg
gtggtgctgacgcgcaagctgctgcccacgctgatcgagcgcaaaggcgcgatcatcgcc
atcggttcggtcgcggggagctacatttaccccggcggtaacgtctatgcgggctccaag
gccttcgtgaaccacttcacgctcgctttgcgcgccgatctgcatggcacgggcgtgcgc
gtgacgagcatcgagcctggcatggtcgagaccgaattcacgctggtgcgcaccggcagc
caggaggcgtccgacgatctctatcgcggtgccgacccgatgaccgggcaggacattgcc
gatacgatccgctggatcgccgaactgcccccgcatctcaatatcaaccggctcgaactt
atgccggtaaaccaggatttcgccggcttccgcgtcgcgcgcgaacaccactaa

DBGET integrated database retrieval system