KEGG   Erythrobacter sp. YH-07: DVR09_11970Help
Entry
DVR09_11970       CDS       T05587                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
err  Erythrobacter sp. YH-07
Brite
KEGG Orthology (KO) [BR:err00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DVR09_11970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AXK42946
UniProt: A0A345YG94
Position
complement(2444289..2444687)
Genome map
AA seq 132 aa AA seqDB search
MKELFQHAAITDGITVRVSVNFLPEQSRPEAGKWFWVYHIRIENGSHERVQLMTRHWRIT
DGAGLVSHVDGDGVVGEQPVLMPGQSHDYVSGCPLDTPHGSMEGFYTFRGEDGSPLEVRI
PYFPLAAPATAD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagctcttccaacatgccgcgattaccgatgggattacggttcgcgtctcggtg
aatttcctgcccgagcaatcgcgcccggaagcgggaaagtggttctgggtctatcacatc
cgtatcgaaaacggctctcacgagcgcgtccagcttatgacccggcattggcggatcacc
gacggggccgggctagtcagccatgtcgatggcgatggcgtggttggcgaacagccggtt
ctgatgccggggcagagccatgattacgtttcgggctgcccgctcgacacccctcatggc
tcgatggaaggcttctacacgttccgcggcgaggatggctctccgctggaagtgcgcatt
ccgtatttcccgctcgccgccccggcaaccgcggattaa

DBGET integrated database retrieval system