KEGG   Erysipelothrix rhusiopathiae SY1027: K210_01610Help
Entry
K210_01610        CDS       T02688                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ers  Erysipelothrix rhusiopathiae SY1027
Pathway
ers00620  Pyruvate metabolism
ers01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ers00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K210_01610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ers02000]
    K210_01610
Enzymes [BR:ers01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     K210_01610
Transporters [BR:ers02000]
 Other transporters
  Primary active transporters [TC:3]
   K210_01610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Clathrin
Motif
Other DBs
NCBI-ProteinID: AGN23957
Position
307364..308761
Genome map
AA seq 465 aa AA seqDB search
MQTIKINDVTVRDGNQSLLATRMEHEDILKILAEMDQVGLNAIEVWGGATFDGALRFFKR
SPWQNLRDMKRVAPNTPFSMLLRGQNIVGYHHYDNDTLERFIRLSLENGIDIIRVFDALN
DIENVKNAIYFIKKHGGHCQGAISYTVSPVHNIDYYVTYAKQLVQAGSDSICIKDMAGIL
LPDVTFELVKRLKEELDVPINLHSHATTGLSSLVFEQAMKAGVDIVDGCISPFSNGTSHI
ALETLLETAHVTNRETTLTHTALQGAYEEANELATKYIASGQYPAKALMINPNILTYQVP
GGMLSNLMSQLKDQGASDRYEEVLKEIPKVREDLGYPPLVTPLSQMVGTQAVLNVLTGTR
YKMVPKEIKDYAMGLYGTFPGPVNEEIINLILKDEKRVEKQPVESMPSVHEANKIELESK
LGREALEEEVLSYILFPQNAILEGEEPKARPEFIEFKMFDGGAVK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaattaaaattaatgatgtaacggtacgtgatggaaatcagtcgttacttgca
acacgtatggaacatgaagacatccttaaaattttagcggaaatggaccaagtaggtctg
aatgcgattgaagtttggggcggtgctacctttgatggtgcacttcgtttctttaagcgc
agtccatggcaaaatttaagagatatgaaacgcgttgcacccaatacacctttttcgatg
ttgttacgaggtcaaaacattgtaggatatcaccattatgataacgatacgttagaacga
tttattcgtctaagtcttgaaaatgggattgatattattcgtgtatttgatgctttgaat
gatattgaaaatgtaaagaatgcaatctattttattaagaaacatggtggacactgtcaa
ggagcaatttcttatacggtaagtcctgttcataatattgattattatgttacttatgca
aaacagttggttcaagctggatcggactcgatttgtatcaaagatatggcgggaatttta
ttaccggatgtaacctttgaacttgtgaagcgtttaaaagaagaacttgatgttccaatt
aaccttcattcacatgcaacaacaggtctttcaagtcttgtttttgaacaagcgatgaaa
gctggtgtcgatattgtggatggttgtatttcaccattttcaaatggaacatcccatatt
gcattggaaacactgctcgaaactgcacatgtcacaaatcgtgaaactacacttacacac
actgccttacaaggcgcatacgaagaagcaaatgaacttgcaacgaaatacattgcaagt
ggtcaatatcctgcgaaagcattaatgattaatcccaatattttaacgtatcaagttcct
ggtggaatgctcagtaatttaatgagtcagttaaaagatcaaggtgcatccgatcgttac
gaagaagttttaaaagaaattcccaaagttcgtgaagatttgggttatccaccgttagtg
acacccctgtcacaaatggtaggaacacaagcagtcttgaatgtcttaacaggcacccgt
tataaaatggtacctaaggaaattaaagattatgctatgggtctttatggcacattccca
ggtcctgttaacgaggagattattaaccttatcttgaaagatgaaaaacgtgttgaaaaa
caacctgttgaatccatgccaagtgttcatgaagcaaataaaattgaacttgaatcaaaa
ttaggtcgtgaagctttagaagaagaagtgttatcctatattctcttccctcaaaatgct
attttagaaggtgaagaacctaaagcacgtcctgaattcattgaattcaagatgtttgat
ggaggagctgtgaaatga

DBGET integrated database retrieval system