KEGG   Erysipelothrix rhusiopathiae SY1027: K210_07535Help
Entry
K210_07535        CDS       T02688                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
ers  Erysipelothrix rhusiopathiae SY1027
Pathway
ers00900  Terpenoid backbone biosynthesis
ers01110  Biosynthesis of secondary metabolites
ers01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ers00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K210_07535
Enzymes [BR:ers01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     K210_07535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AGN25085
Position
complement(1406514..1407746)
Genome map
AA seq 410 aa AA seqDB search
MYNKFYKKTITERRNVLNDQKNYDFDLDIPLSSEIYEHMIENAVTTYEIPMGCAPNFLIN
NQDYVIPMVTEEPSVIAAASNAAKIMKHNGGIHARIYKRNMIGQIAFANPHNQISMIQYL
DDNRDLLFKIAHDAYPSIVKRGGGLRHIHTAFINKPHKTPFLIVYCTIDTQEAMGANMMN
TILEAIGNHLESVFDEHPLMAILSNLATECLAEARVIIDPQTLRFPDDIALRIQQASHLA
EVDPYRAATHNKGIMNGIDAVVIATGNDWRAIEASVHSYASLTGSYQPLATWCINSDNMI
EGTIKLPLPIGTVGGSIAIHPKAQLSRKILGYQNAEELMMILASVGLAQNFAALYALTTV
GIQNGHMKLQAKSLALAVGCPSEDVDRLVEKLLKEPKLNQDVAKKLLQEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtacaataaattttataaaaaaacgataacagaacgtcgtaatgtattaaatgatcaa
aagaattacgatttcgatcttgatattcctctgagctcagagatttatgaacatatgata
gaaaatgcggtcactacgtatgaaatcccaatgggttgtgctccaaatttcttgataaac
aatcaagactatgtcattcctatggtaactgaggaaccttctgtaatcgcggccgcaagt
aatgccgcgaaaatcatgaagcataatggaggcatccacgctcgtatttataagcgcaat
atgatcggacaaattgcctttgcgaatcctcataatcaaatatcaatgattcagtactta
gatgataaccgcgatttattatttaaaatcgcacatgacgcatacccttctattgttaaa
cgtggtggtggtctacgtcatattcatactgcgtttatcaacaagccccataaaacacct
tttttaattgtttattgtactattgatacccaagaagccatgggtgcaaacatgatgaat
acaatcttagaagcaattggaaatcatcttgaatcagtcttcgatgaacatccactcatg
gccatattatcgaatctcgcaaccgaatgtttggcagaagcacgtgttataatcgatccc
caaacacttcgtttccctgatgatatcgccttacgaatccaacaagcaagtcatcttgcg
gaagtagacccttaccgtgctgcaacacataataagggaatcatgaatggtatcgatgcc
gttgttatcgcaacaggaaatgattggcgagcaatcgaagcctctgtgcatagttatgca
tcactcacaggcagctatcaaccgctagccacatggtgtataaattcagataacatgatt
gaaggtacaattaaacttccgcttcctattggtactgtcggtggttccattgcaatccac
cctaaggcacagttgagtcgtaaaattttaggatatcagaatgctgaagaactgatgatg
attctagcatctgttggactcgcacaaaacttcgcagctctttacgcacttacaactgtt
ggaattcaaaatggtcatatgaaacttcaagcaaaatctctagccttagctgtgggatgt
ccttctgaagatgttgatcgtcttgtagagaaattactcaaagaacctaagttaaatcaa
gatgttgctaaaaaattacttcaagaattataa

DBGET integrated database retrieval system