KEGG   Erysipelothrix rhusiopathiae SY1027: K210_08050Help
Entry
K210_08050        CDS       T02688                                 

Definition
(GenBank) rRNA (guanine-N1-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ers  Erysipelothrix rhusiopathiae SY1027
Brite
KEGG Orthology (KO) [BR:ers00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ers03009]
    K210_08050
Enzymes [BR:ers01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     K210_08050
Ribosome biogenesis [BR:ers03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    K210_08050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 OrfB_Zn_ribbon Methyltransf_32 YhfH Methyltransf_12 MTS TPMT zf-ribbon_3 Methyltransf_23 zf-TFIIB Methyltransf_29 zinc-ribbons_6 DUF1610
Motif
Other DBs
NCBI-ProteinID: AGN25182
Position
1513379..1514182
Genome map
AA seq 267 aa AA seqDB search
MTYFKCPNCGQALEEQDRSYVCSKGHQFDRAKSGYVNLLMSQKDKMKQHGDDKQMVRARR
DFLDKGYYGLLLEQIKNVFDKFSCKQILDAGCGECWYTESLLKPERTVYGVDISKNAVDL
GSKRNSDLTLAVGSTFDLPIISDSFDGCLSVFAPFKIEEVLRVLKEDGIFIQVFPLANHL
MELKEIVYDQPYPNDVDVKMYEGFQLLDVMQIKGPIDITSTEDILNVFAMTPYAHRTPKE
NIERLTQYSHINVGLEFGLAIYRKETL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacatattttaaatgtccgaattgtggacaagcattggaagaacaggatcgttcatac
gtatgttctaagggtcatcagtttgatcgggccaagagtggttatgtaaatttgctcatg
tctcaaaaagataaaatgaagcaacatggcgatgataagcagatggttcgtgcccgtaga
gattttttagataaaggttattatggattattgcttgagcagattaaaaatgtttttgat
aagttttcgtgcaagcaaatcttggatgcgggatgcggtgagtgttggtatacagaatca
ttactgaaacccgaaaggaccgtttatggtgttgatatttcgaagaatgcggttgattta
ggatcaaagcgtaattctgatttgacgctcgctgttggtagtacctttgatttaccgatc
attagtgattcttttgatggatgtttatctgttttcgccccatttaaaattgaagaagtc
ttaagggtattaaaagaagatggcatttttattcaggtatttccacttgcaaatcatttg
atggaactgaaagaaattgtttatgatcaaccttatcccaatgatgttgatgtgaagatg
tatgaaggatttcaattgcttgatgtaatgcaaattaagggacctatcgacattacatcg
actgaggatattttaaatgtttttgcgatgacaccgtatgcacatcgtacacctaaagaa
aatattgaaagactgacgcagtattcacacataaatgtgggcttagagtttggtcttgca
atttatagaaaagagacattatga

DBGET integrated database retrieval system