KEGG   Eubacterium rectale DSM 17629: EUR_03510Help
Entry
EUR_03510         CDS       T02587                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
ert00071  Fatty acid degradation
ert00280  Valine, leucine and isoleucine degradation
ert00310  Lysine degradation
ert00362  Benzoate degradation
ert00620  Pyruvate metabolism
ert00630  Glyoxylate and dicarboxylate metabolism
ert00640  Propanoate metabolism
ert00650  Butanoate metabolism
ert00900  Terpenoid backbone biosynthesis
ert01100  Metabolic pathways
ert01110  Biosynthesis of secondary metabolites
ert01120  Microbial metabolism in diverse environments
ert01130  Biosynthesis of antibiotics
ert01200  Carbon metabolism
ert01212  Fatty acid metabolism
ert02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ert00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EUR_03510
   00630 Glyoxylate and dicarboxylate metabolism
    EUR_03510
   00640 Propanoate metabolism
    EUR_03510
   00650 Butanoate metabolism
    EUR_03510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EUR_03510
   00072 Synthesis and degradation of ketone bodies
    EUR_03510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EUR_03510
   00310 Lysine degradation
    EUR_03510
   00380 Tryptophan metabolism
    EUR_03510
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EUR_03510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EUR_03510
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EUR_03510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ert04147]
    EUR_03510
Enzymes [BR:ert01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EUR_03510
Exosome [BR:ert04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EUR_03510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF1153 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBK89573
UniProt: D6E2D3
Position
371815..372999
Genome map
AA seq 394 aa AA seqDB search
MAKKVVIASACRTAIGKMGGALSNTPAADLGAIVIKEALNRAGVAPEMVDEVKMGCVIQA
AQGQNVARQASIKAGLPIEVPAITINVVCGSGLKCVNDAATMIKAGEADIVVAGGMENMS
MAPYAMTKARFGYRMNNATIIDTMVNDALTDAFNHYHMMITAENVCDKYGITREELDEFS
ANSQQKCEAAIAAGKFDDEIVPVPVKVKKEIVEFKKDEGPRAGTTVETLSKLRCCSGKEG
GLVTAGNASGINDGAAAVVVMSEEKAKELGVKPLATWVAGALGGVEPEIMGVGPVASTKK
VLAKTGLTIDDFDLIEANEAFAAQSIAVARDLGFDMSKVNVNGGAIALGHPVGASGCRIL
VTLLHEMQKRGSNRGLATLCIGGGMGCSTIVEKY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagttgtaatcgcaagtgcttgccgtacagcaatcggcaaaatgggcgga
gcattaagcaatactccagccgcagatttaggtgcaatcgtaattaaggaggctttaaac
cgtgcaggtgttgctcctgagatggttgacgaggttaagatgggttgtgttatccaggca
gctcagggacagaacgtagctcgtcaggcttctatcaaggcaggacttccaatcgaggtt
ccggctatcacaatcaacgttgtttgtggatcaggtcttaagtgcgtaaacgacgctgct
acaatgatcaaggccggtgaggctgatatcgttgttgccggtggtatggagaacatgtca
atggctccttacgctatgacaaaggcacgtttcggatacagaatgaacaatgcaacaatc
atcgatacaatggttaacgatgctcttacagatgcattcaaccactatcatatgatgatc
acagctgagaatgtatgtgataaatacggcatcactcgtgaagagcttgatgagttctca
gcaaactcacagcagaagtgtgaggcagctatcgcagcaggcaagttcgatgatgagatc
gttcctgtacctgttaaggttaagaaagaaatcgttgagttcaaaaaggacgagggacct
cgtgccggaacaacagtagagactctttctaagcttcgttgctgctcaggtaaagagggc
ggacttgttacagccggtaacgcatcaggaatcaatgatggtgctgcagcagtagttgta
atgagcgaagagaaagctaaggagctcggcgttaagccattagctacatgggtagcagga
gcacttggcggagttgagcctgagatcatgggtgttggacctgtagcttctacaaagaag
gttcttgcaaagactggtcttacaattgatgatttcgatcttatcgaggcaaacgaggca
tttgctgcacagtcaatcgctgtagcaagagatcttggtttcgatatgagcaaggtaaat
gtaaacggtggtgctatcgcactcggacatcctgtaggagcttcaggctgccgtatcctt
gttacattattacatgagatgcagaagagaggatctaacagaggtcttgcaacactttgt
atcggtggtggaatgggatgttctactatcgttgagaagtactaa

DBGET integrated database retrieval system