KEGG   Eubacterium rectale DSM 17629: EUR_12060Help
Entry
EUR_12060         CDS       T02587                                 

Definition
(GenBank) Pyruvate/oxaloacetate carboxyltransferase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
ert00620  Pyruvate metabolism
ert01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ert00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EUR_12060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ert02000]
    EUR_12060
Enzymes [BR:ert01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EUR_12060
Transporters [BR:ert02000]
 Other transporters
  Primary active transporters [TC:3]
   EUR_12060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: CBK90321
UniProt: D6E4I1
Position
1224809..1226227
Genome map
AA seq 472 aa AA seqDB search
MSEVVKKPLKITETVLRDAHQSLIATRMTTEQMLPIVDKMDKVGYNAVECWGGATFDACL
RFLKEDPWDRLRKLRDGFKNTKLQMLFRGQNILGYRPYADDVVEYFVQKSIANGIDIIRI
FDCLNDIRNLQTAVTACNKEKGHAQVALSYTLGDAYTLDYWMDMAKRVEDMGADSLCIKD
MAGLLVPAKATELVQALKDSTSLPVELHTHYTSGVASMTYMKAVEAGVDIIDTAMSPFAL
GTSQPATEVMVEAFKGTEFDTGLDLNLLSEIADYFRPMREEALASGLMNPKVLGVNINTL
RYQVPGGMLSNLISQLKEQGKEDKYEEVLAEVPRVRKDLGEPPLVTPSSQIVGTQAVFNV
LMGERYKVATKETKDILLGKYGQTVKPFNPEVVDKVLGDDKKNAITCRPADLLEPELDKI
EAEMKQWKQQDEDVLSYALFPQVATDFFKYRQAQQTGVDAKAADTENKAYPV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagtggtaaagaaaccattaaaaataacagaaactgttcttcgtgatgcacat
cagtcactgattgcaaccagaatgacaacagagcagatgcttccaatcgttgacaaaatg
gacaaggttggatacaacgcagtagagtgctggggtggtgcaacatttgatgcctgcctt
agattcttaaaggaagatccatgggatcgtctcagaaaattaagagacggcttcaaaaat
acaaagctccagatgcttttccgtggacagaatatcttaggatatcgtccatatgcagat
gatgtcgttgagtatttcgtacagaagtcaatcgcaaacggaatcgatatcatccgtatt
ttcgactgcttaaatgatatcagaaacttacagacagcagttacagcatgtaacaaggaa
aagggacatgcccaggtagctctttcatacacacttggagatgcttacacacttgactac
tggatggatatggcaaagagagttgaggacatgggtgctgactcactttgtatcaaggat
atggccggtcttttagttcctgcaaaggctacagagcttgttcaggctttaaaggattct
acaagccttcctgtcgagcttcatacacactacacatcaggtgttgcttcaatgacatac
atgaaggctgttgaggccggagttgatatcattgacacagctatgtcaccattcgctctt
ggaacaagccagcctgcaacagaggttatggttgaggcattcaagggcacagagtttgat
acaggtcttgatcttaatctcttaagtgagattgctgattacttcagaccaatgagagag
gaagctttagcttcaggtctcatgaacccaaaggtactcggagtaaatatcaatactctc
cgttatcaggttcctggaggaatgctttcaaaccttatttcacagctcaaggagcagggc
aaagaggacaagtacgaggaggttctcgcagaggtacctcgtgtgcgtaaagacctcggt
gagccaccacttgtaactccttcttcacagatcgttggtacacaggctgtatttaacgta
ctcatgggcgagagatacaaggttgctactaaggagactaaggatatccttcttggtaag
tatggtcagacagttaagcctttcaacccagaggttgttgacaaggttcttggtgatgat
aagaagaatgccatcacatgtcgtccggcagatcttcttgagccagagcttgacaagatt
gaggctgagatgaagcagtggaaacagcaggatgaggatgttctttcttatgctcttttc
ccacaggttgctactgatttcttcaagtacagacaggcacagcagacaggtgttgatgca
aaggccgctgatactgagaataaggcttatcctgtatag

DBGET integrated database retrieval system