KEGG   Eubacterium rectale DSM 17629: EUR_16600Help
Entry
EUR_16600         CDS       T02587                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
ert00010  Glycolysis / Gluconeogenesis
ert00020  Citrate cycle (TCA cycle)
ert00620  Pyruvate metabolism
ert01100  Metabolic pathways
ert01110  Biosynthesis of secondary metabolites
ert01120  Microbial metabolism in diverse environments
ert01130  Biosynthesis of antibiotics
ert01200  Carbon metabolism
Module
ert_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ert00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUR_16600
   00020 Citrate cycle (TCA cycle)
    EUR_16600
   00620 Pyruvate metabolism
    EUR_16600
Enzymes [BR:ert01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     EUR_16600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP PEPCK_GTP AAA_33
Motif
Other DBs
NCBI-ProteinID: CBK90722
UniProt: D6E5N2
Position
complement(1662885..1664489)
Genome map
AA seq 534 aa AA seqDB search
MANVDLTKYGITGTTEIVHNPSYETLFEEETKAGLEGYEVGKETELGAVNVMTGIYTGRS
PKDKYIVMDENSKDTVWWNTPEYPNDNHPMKEDVWATVKDLAKKELCNKKLFVVDAFCGA
NKDTRMAVRFIVEVAWQAHFVTNMFIQPSAEELENFEPDFVVYNASKAKVENYKELGLNS
ETCVAFNITSKEQVIINTWYGGEMKKGMFSMMNYYLPLKGIASMHCSANADMNGENTAIF
FGLSGTGKTTLSTDPKRLLIGDDEHGWDDNGVFNFEGGCYAKVIGLDKESEPDIYNAIRR
DALLENVTVADDGKIDFEDKSVTENTRVSYPINHITNIVKPVSSAPAAKNVIFLSADAFG
VLPPVSILTPEQTQYYFLSGFTAKLAGTERGITEPTPTFSACFGQAFLELHPTKYAAELV
KKMEKSGAKAYLVNTGWNGTGKRITIKDTRGIIDAILSGDILNAPTKKIPMFDFEVPTEL
PGVDSGILDPRDTYADASEWEAKAKDLAERFNKNFVKYTTNEAGKALVAAGPQL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgttgatttaacaaagtatggcattaccggaacaacagagatcgttcacaat
ccttcttacgagacattattcgaggaagagacaaaagccggccttgagggttacgaggtt
ggtaaggagacagagcttggtgcagttaacgttatgacaggtatctacactggacgttct
cctaaagataaatatatcgttatggacgagaattctaaggacacagtatggtggaataca
cctgagtatccaaacgacaaccatccaatgaaagaggatgtttgggcaacagttaaggat
cttgctaagaaagagctctgcaacaagaagcttttcgtagtagatgcattctgtggagca
aacaaggatacacgtatggcagttcgtttcatcgttgaggttgcttggcaggctcatttc
gtaacaaacatgttcatccagccatcagcagaggagcttgagaacttcgagcctgatttc
gtagtatacaatgcttcaaaggctaaggttgagaactacaaggagttaggtcttaactca
gagacatgtgttgcattcaacatcacatcaaaagagcaggttatcatcaatacatggtac
ggcggagagatgaagaagggtatgttctctatgatgaactactacctcccacttaagggc
atcgcttcaatgcactgttcagcaaacgctgacatgaacggagagaacacagcaatcttc
ttcggtctttcaggaacaggtaagacaacactttctacagatcctaagcgtcttcttatc
ggagatgacgagcacggctgggatgacaacggcgtattcaacttcgagggtggatgctac
gctaaggttatcggtcttgacaaagagtctgagcctgatatctacaacgcaatcagaaga
gatgctcttcttgagaacgttacagttgctgatgatggaaagattgatttcgaggacaag
agtgtaacagagaatacacgtgtatcttacccaatcaaccacatcacaaatattgttaag
ccagtatcttcagcaccggctgcaaagaacgtaatcttcctttcagcagatgcattcgga
gtacttccaccagtatctattcttacacctgagcagacacagtactacttcctttcagga
tttactgcaaagcttgcaggaacagagcgtggaattactgagccaacacctacattctca
gcttgcttcggacaggcattccttgagcttcatcctacaaaatacgctgcagagctcgtt
aagaagatggagaagtcaggcgctaaggcataccttgtaaatacaggatggaacggaaca
ggaaagagaatcacaatcaaggatacaagaggaatcatcgacgctatcctttctggtgat
atccttaatgctccaacaaagaagatccctatgttcgatttcgaggttcctacagagctt
cctggagttgattcaggaatccttgatcctcgtgacacatatgctgatgcttctgagtgg
gaggcaaaggctaaagatcttgcagagagattcaacaagaactttgttaagtacacaaca
aatgaggctggtaaagcacttgttgcagcaggaccacagttataa

DBGET integrated database retrieval system