KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum0280
Entry
Erum0280          CDS       T00224                                 
Symbol
virB10
Name
(GenBank) type IV secretion system protein VirB10
  KO
K03195  type IV secretion system protein VirB10
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eru00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Erum0280 (virB10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eru02044]
    Erum0280 (virB10)
Secretion system [BR:eru02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Erum0280 (virB10)
SSDB
Motif
Pfam: TrbI SpoIIIAH FAM176
Other DBs
NCBI-ProteinID: CAH57735
Position
complement(34633..35979)
AA seq 448 aa
MSEENYNNHNNIELEESVNVVGTHKGKKAIIVGALVVVLGLTYYFFFNNKKTDDSTTTSK
SSQEVDIEKLLKDSVPPAQEVSPMVNIPPQLPELPPLVSPSLPSLPTIEKPKVLEVPKIV
QKEKKIPAPLPTVETKSEPEVKIPLPTQNNVEVVTPIAPTTTGYDKERRTTSMLTISGGQ
DLTAGQNNEEGTDPNNKIGNFVDSVMSFKPTSSPNVVATKINNLELTILQGKIIDVVLET
AINSDLQGTLRGIVARDVYSEAGNVVMIPKGSRLIGNYSFNASPGKTRVQISWNRVILPH
GVDIALDSTGTDELGRQGASGVVDTKVGSILTSTILLAGVSIATSYVTSKIPEINDHPII
ESKSDDKDKDKDKDKDKDKDKDKTKTTLPVKILSKAVDDFSQSIKDIIQKYTNNNPTVYV
DQGTLLKVFVNKDIVFPKEAVRGINVVN
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtcagaagaaaattacaataaccacaataacatagaacttgaagaaagtgtcaatgtt
gtaggaacacataaaggaaaaaaagctataatagtaggagcacttgtagttgtattagga
ttaacctattactttttcttcaacaacaaaaaaacagatgattcaacaactacatcaaaa
tcatcacaagaagtagacatagaaaaattattaaaagattctgtaccaccagctcaagag
gtttctccaatggtaaatattccacctcaattaccagagttacctccattagtatcacca
tctttaccatcactaccaactattgaaaaacctaaagtattagaagtaccaaaaattgta
caaaaagaaaaaaaaataccagcacctttaccaaccgttgaaactaaatcagaaccagaa
gttaagatacccctacctactcaaaataatgtagaagtagttacacctattgcaccaaca
acaacaggatatgataaagagagaagaacaacatccatgcttaccatatcaggagggcag
gatttaacagctggacaaaacaatgaagaaggtactgatcctaataacaaaattggtaat
tttgtagattcagtaatgtcattcaaacccacatcgtctcctaatgtagtagcaacaaaa
attaacaatttagaattaacaatcttacaaggtaagataattgatgtagttttagaaact
gcaattaattctgacctacaaggtacattaagaggcatagtagcacgtgatgtttattca
gaagctggtaacgtagttatgataccaaaaggatcaagacttataggtaattattctttc
aatgccagcccaggaaaaactagagttcaaatatcctggaacagagtaattctacctcac
ggcgtagatatagcacttgattctactggaacagatgaactaggaagacaaggagcatca
ggggttgttgataccaaagttggcagcatattaacctccactatactacttgcaggtgta
tcgatagcaacatcatatgtaacttcaaaaattcctgaaataaatgatcatccaattata
gagtcaaagtctgacgataaggataaagataaagataaagacaaagataaggataaggat
aaagataaaacaaaaaccacattacctgtaaaaattctatctaaagcagtagatgatttt
tcacagtctataaaggacattatacaaaagtatacaaacaataatccaacagtatatgtg
gaccaaggtactctactaaaagtgtttgttaataaagatattgtgtttcccaaagaagca
gtacgtggaataaatgtagtaaattaa

DBGET integrated database retrieval system