KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum0290
Entry
Erum0290          CDS       T00224                                 
Symbol
virB9
Name
(GenBank) type IV secretion system protein VirB9
  KO
K03204  type IV secretion system protein VirB9
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eru00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Erum0290 (virB9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eru02044]
    Erum0290 (virB9)
Secretion system [BR:eru02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Erum0290 (virB9)
SSDB
Motif
Pfam: CagX Fungus-induced
Other DBs
NCBI-ProteinID: CAH57736
Position
complement(36000..36803)
AA seq 267 aa
MMNFYKIFTILLALVTVSNSAYAVNENNNPIAIDSRIKTFIYSNNEVYDVVFNYGYHSYI
EFSKGETIKMLAMGDTASWKVRPIGNKLFIMPLEKNGKTNMLIETSKGRSYAFDLICRSE
NNSNNDKKENDAGYSELRDLAYIVRFYYPKTEEEFELNKIKVPDISIPKSNNVIIKPNST
KHNYTIDNQIEDNKISPVELFDDGKLTYFKFANNNKIIPQIFTYNNSGQKVPCKMLLLQN
YVIIKGVHKNLYIQYKNEFINITNKHL
NT seq 804 nt   +upstreamnt  +downstreamnt
atgatgaatttttataagatttttacaatattattagcactagttacagtaagtaatagt
gcatacgctgtaaatgaaaataataatccaatagcaatagacagtaggattaagactttc
atatacagtaataacgaagtttacgatgtagtatttaactatggctatcattcatatata
gagttttcaaagggagaaactataaaaatgctagcaatgggtgatactgcaagctggaaa
gtcagaccaataggaaataaattattcatcatgccattggaaaaaaatggaaaaacaaac
atgctaatagaaactagtaaaggaagaagttacgcctttgatctcatatgccgtagtgaa
aataattccaataacgataaaaaggaaaatgacgctggatactctgagctaagagatcta
gcttatatagtacgtttctattatccaaaaactgaagaggaatttgaattaaataaaata
aaggtaccagatatttctatacctaaatctaataatgtaattataaaacctaactctaca
aaacacaattatactatagataatcaaatagaagataataaaatatcaccagtagaatta
tttgatgatggaaaattaacatactttaagtttgcaaataataataagattattccacaa
atatttacatataacaattctggtcaaaaggtaccctgtaaaatgctattattacaaaac
tatgtaataataaagggtgtacataaaaatttatatattcaatataagaatgaattcata
aacattactaacaagcatttataa

DBGET integrated database retrieval system