KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum0300
Entry
Erum0300          CDS       T00224                                 
Symbol
virB8
Name
(GenBank) type IV secretion system protein VirB8
  KO
K03203  type IV secretion system protein VirB8
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eru00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Erum0300 (virB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eru02044]
    Erum0300 (virB8)
Secretion system [BR:eru02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Erum0300 (virB8)
SSDB
Motif
Pfam: VirB8
Other DBs
NCBI-ProteinID: CAH57737
Position
complement(36787..37485)
AA seq 232 aa
MFKFGKKNKVSKSSSIPQSENLAHSWHVSRYSSILIQRNILLFLTMLALCTVGVSVFVIS
NISKSRTIEPFVVEIEKKSGITTLVNPISVKQYSADEVLNNYFIIEYVRSRELFDPNNFQ
YNYYTKVRLLSDQTTYAEFRRWTRLSNPASPLNLYANVTSGILKIRSLQHLRPGNVQIRF
SLEFNTPNGVVKKDRIATLSFQYATLEMNEQERQVNPLGFQITYYRADDEFL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtttaaatttggaaaaaagaataaggtaagtaagagtagtagtataccacagagtgaa
aacttggcacatagctggcatgtaagtcgctacagttccattcttatacaaagaaatata
ctattatttcttactatgttagcattgtgtacagtaggagttagcgtttttgtaatttct
aacataagtaaaagtagaactatagaaccatttgtagtagaaatagaaaaaaaatctggt
attactacattagttaatccaatctcagtaaaacaatactcagcagatgaagttttaaac
aattattttataatagagtatgtaagatcaagagaacttttcgatcctaataattttcaa
tataattattatacaaaggttcgtttgctatctgatcaaacaacatatgcagaatttcgt
agatggacaagattaagcaatcctgcaagtcctttaaacttatatgcaaatgtaacttca
ggtattttaaaaattagatcattacaacacttacgtccaggaaatgtacaaataaggttc
tctttagagttcaataccccaaatggggtagtgaaaaaagataggatagctactttgtca
ttccaatatgcaactctcgaaatgaatgagcaagaacgtcaagtcaatcctttaggattt
caaataacttactatagggcagatgatgaatttttataa

DBGET integrated database retrieval system