KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_03100Help
Entry
ERWE_CDS_03100    CDS       T00233                                 

Gene name
surE
Definition
(GenBank) Acid phosphatase surE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
erw00230  Purine metabolism
erw00240  Pyrimidine metabolism
erw00760  Nicotinate and nicotinamide metabolism
erw01100  Metabolic pathways
erw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:erw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ERWE_CDS_03100 (surE)
   00240 Pyrimidine metabolism
    ERWE_CDS_03100 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ERWE_CDS_03100 (surE)
Enzymes [BR:erw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     ERWE_CDS_03100 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: CAI26804
UniProt: Q5HBM5
Position
510914..511690
Genome map
AA seq 258 aa AA seqDB search
MRNKGTMRVLLSNDDGFHANGIKALKEIVIKSGIASEIWVVAPLNNCSGSGRSVGLNVKV
QVSKVSDTEFIVDSTPSTSVFLALRKIMNYKPDLILSGINHGVNIGNDVWYSGTVAAAAE
GAAINIPSIAISQEYDNKSGEINWVNPQRFLKQIIEMLMNVSFWNKSTVMNVNFPLMPAK
GIKFTDQGKYVPCNEIEKNESSDDSNVSYTITRITPNKKNRAQCDGSIKAIDEGYITITP
LKFDMTDFDVLTSLNSLK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaataaaggtaccatgagggtattattgagtaatgatgatggttttcatgcaaat
ggcataaaagcactaaaggaaatagtaataaaatctggtattgcatctgagatatgggta
gttgctccattaaataattgtagtggttctggaagatcagtaggattaaatgttaaagtg
caggtttctaaggtaagcgatactgaatttattgttgatagtactccgtctacaagtgtt
tttcttgcattaagaaaaatcatgaattataaacctgatttaattttatctggtataaat
catggggtcaatataggaaatgatgtctggtattctggaactgtggcggctgcagcagaa
ggggctgctattaatattccatcaattgctattagtcaggaatatgataacaagagtgga
gaaataaattgggtaaatccacaaagatttttaaaacagattatagaaatgttaatgaat
gtttcattttggaataaatctactgttatgaatgtaaactttccattaatgccagcaaag
ggaatcaaatttacggatcaggggaaatatgtaccatgtaatgaaatagaaaaaaatgaa
agttctgatgatagcaatgtctcttatacaattactagaataaccccaaataaaaaaaat
agagcacaatgtgatggtagtattaaggctattgatgaaggatatatcacaattacacca
ttaaaatttgatatgacagattttgatgttttaacatctttgaattcacttaaataa

DBGET integrated database retrieval system