KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_08370Help
Entry
ERWE_CDS_08370    CDS       T00233                                 

Gene name
gatC
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
erw00970  Aminoacyl-tRNA biosynthesis
erw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ERWE_CDS_08370 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:erw03029]
    ERWE_CDS_08370 (gatC)
Enzymes [BR:erw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ERWE_CDS_08370 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ERWE_CDS_08370 (gatC)
Mitochondrial biogenesis [BR:erw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ERWE_CDS_08370 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: CAI27331
UniProt: A0A0H3M0R8
Position
1329674..1330018
Genome map
AA seq 114 aa AA seqDB search
MIRNKLIDNQNNSNNLQQKKITKDDLLQVAKLVKVKLSDNEIGYYIKELESVLSWINTIS
QVNTDNVIPMSHGGISHKLPLRQDIINDGNIKDIILSESPKQEHDFFVVPKVIE
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgataagaaacaaattgatagacaatcaaaataattcaaataacttgcaacagaaaaag
ataaccaaggatgatctgctacaagttgcaaagttagtcaaagtaaaattgagtgacaat
gaaatcggttattatattaaggagttagaatctgttttgagttggataaatacaatatca
caagtaaacacagacaatgttatcccaatgagtcatggtggaataagtcataaattacct
ctacgtcaagacattatcaatgatggcaatataaaagacattatactttctgagtctcct
aaacaagaacatgacttttttgttgtaccaaaagtcattgagtaa

DBGET integrated database retrieval system